KEGG   Thauera sp. MZ1T: Tmz1t_1847Help
Entry
Tmz1t_1847        CDS       T00804                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tmz  Thauera sp. MZ1T
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tmz1t_1847
Enzymes [BR:tmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tmz1t_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2073454..2075505)
Genome map
AA seq 683 aa AA seqDB search
MSPIHASPSPAAAPHAATAPSAPTDALLATLDAWTDAGLLRQLDSAFARFIASLDPAAPP
ALLVGAAVLARMEGRGHSCLPLAPLAATDQDLLAWPMEAQAAIAALWQNLPADSAAWLAA
LQQSPVVRRIGHDPELGQPLLVDGPDTAPRLYLRRYWQYERSVAAAVAARCAQPEPVDEA
RARTWLDRLFPAAPGTPAHEAAVDWQKLACAIALRGRLSILTGGPGTGKTYTAARLLALM
LATHPAPERLRIALAAPTGKAAARLRQAIDGSLQALQRSLGGHLDLAALTRRIGAARTLH
ALLGARPDTRRFRHHAGNPLDVDVVIVDEASMVHLEMMAALLEALPHGARLVLLGDKDQL
ASVEAGAVLGDLCRDASDGRYDAETARYLLATTGEALPTRYLEPTDKAPALAQHTVMLRE
SRRFEGPIGALAHAVNAARDPALPARLLREDASGALHGVEGGPVAAVIALALGGRRGAPA
CYRDYLELLARGPAGKDAEAHAAWATAILHAFDRFRVLCAVREGDWGMAGLNRAIEHALA
RARLLSPRGTWYAGRPVMVTRNDPALGVFNGDIGITLPALESGGLRVHFLDGEALRSVAA
SRLAHVETAFAMTVHKSQGSEFEHTVLVLAAQSGNVLVRELIYTAITRARKAFSLVAERE
GLLEHGVLQATRRESGLLDFQGT
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgagccccatccacgcttcgccctcgcctgccgcggcgccacacgcggcgacagcgccc
tccgcgccgaccgacgccctcctcgccaccctcgacgcctggacggacgccggcctgctg
cgccagctcgacagcgccttcgcccgtttcatcgccagcctcgaccccgccgcgccgccc
gcgctgctggtgggcgcagcggtgctggcgcgcatggagggccgcggccatagctgcctg
ccgctcgccccgctcgccgcgaccgaccaggatctgctggcctggccgatggaggcccaa
gcggcgatcgccgcgctgtggcagaacctgcccgccgattccgccgcctggctggcggcg
ctgcagcaaagccccgtggtgcgccgcatcggccacgaccccgaactcggccagcccctg
ctggtggacggacccgacaccgcaccgaggctctacctgcgccgttactggcagtacgag
cgcagtgtcgccgccgcggtggcggcgcgctgcgcgcaacccgagccggtcgacgaggcg
cgtgcgcgcacctggctggaccgcctctttccggccgcgcccggcactccggcccacgag
gcggcggtcgactggcagaagctcgcctgcgcgatcgccttgcgcgggcgcctgagcatc
ctcaccggcggccccggtaccggcaagacctacaccgccgcgcgcctgctcgcgctgatg
ctcgccacccacccggcgcccgagcgcctgcgcatcgcgctcgccgcccccaccggcaag
gccgccgcgcgcctgcgccaggccatcgacggctcgctgcaggccctccagcgcagcctg
ggcggccacctcgacctcgccgcgctgacccgccgcatcggcgccgcgcgcaccctgcac
gcgctgctcggcgcccgtcccgacacgcggcgcttccgccaccacgccggcaatccgctc
gacgtggacgtggtgatcgtggacgaagcctcgatggtgcacctggagatgatggccgcc
ctgctcgaagccctgccgcacggcgcgcgactggtgctgctcggcgacaaggaccagctc
gcgtcggtcgaggccggcgcggtgctcggcgacctctgccgcgacgcctcggacggacgc
tacgacgccgagaccgcacgctacctgctcgccaccaccggcgaggccctgcccacgcgc
tacctggagcccacggacaaggcgcccgcgctcgcccagcacaccgtgatgctgcgcgag
agccggcgcttcgaggggccgatcggcgcgctcgcgcacgcggtcaacgcggcgcgcgac
ccggccctgcccgcgcgcctgctgcgcgaggatgcgagcggcgcgctgcacggggtcgag
ggcggaccggtggcggcggtgatcgcgctcgcgctcggcggccgcaggggcgcacccgcc
tgctaccgcgactatctggagctgctcgcacgcggaccggcaggcaaggacgccgaggcg
cacgcagcgtgggcgacggcgatcctgcacgccttcgaccgcttccgcgtgctgtgcgcg
gtgcgcgaaggcgactggggcatggccgggctcaaccgcgcgatcgagcacgcgctcgcg
cgcgcgcgtctgctgtcgccacgcgggacctggtacgccgggcgcccggtcatggtcacc
cgcaacgaccccgcgctcggcgtcttcaacggcgacatcggcatcaccctgccggcgctc
gagagcggcggcctgcgggtgcacttcctcgacggcgaggccttgcgctcggtggcggcg
agccgcctcgcccatgtcgagaccgcgtttgcgatgacggtgcacaagagccagggctcg
gagttcgagcacacggtgctggtgctcgccgcgcagagcggcaacgtgctcgtgcgcgag
ctgatctacaccgcgatcacgcgcgcccgcaaggccttcagcctggtggccgaacgcgag
ggcctgctggagcatggcgtgttgcaggcgacccggcgcgagagcgggctgctggacttt
cagggaacgtag

DBGET integrated database retrieval system