KEGG   Thauera sp. MZ1T: Tmz1t_2046Help
Entry
Tmz1t_2046        CDS       T00804                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00500  Starch and sucrose metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tmz1t_2046
Enzymes [BR:tmz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Tmz1t_2046
Exosome [BR:tmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tmz1t_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase DUF3459 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACK54794
JGI: Tmz1t_2046
UniProt: C4ZP36
Position
complement(2312915..2315107)
Genome map
AA seq 730 aa AA seqDB search
MDPDLARVAPESLQSLLQASHADPFALLGAHPVAGGMVLRTLLPGAQAVVVLDIDGRPLL
ELQPQDGSPLFIGALPGGSHPLRYRLHVRWSGGGETRFDDAYRFGALIEDLDVWLLAEGS
HHRPYEWLGAHPVTVDGVAGTRFAVWAPNARRVSVVGGFNAWDGRRHMMRHRRECGVWEI
FLPGIGEGELYKYEILGADGVVRLKADPFAFRAELRPHTASVVQRLLPGLAIDEARRRAN
ALDAPISIYEVHLGSWQRKEDGGWLSYRELAERLVPYAVGLGFTHLELLPVHEHPFDGSW
GYQPTGLYAPSARFGTPEDFRAFTDAARAAGLGVILDWVPAHFPSDAHGLAEFDGTHLYE
HADPREGFHQDWNTLIYNYGRAEVRNYLASNALYWIERFGADGLRVDAVASMLYRDYSRR
EGEWVPNRFGGRENLEAIDFLRRMNHLVGTQRPEAITLAEESTAFPAVSRPPSPDLQGGG
LGFHYKWNMGWMNDLLAYLARDPVHRKHHHDQLRFSLAYAFSENFVLPLSHDEVVHGKGS
LLAKMPGDVWQKFANLRLLYGYMWAHPGKKLLFMGCEFAPWSEWNADASLPWELLGHAPH
AGMQRLVRDLNRVLRSHPALYEQDTASEGFRWISHDDAAHSVLVFERRARDGRSVVVACN
FTPVAREGWRTGIPAAGTWRELLNTDDPVYGGSGVTNGALRSEALPWQGEAQSIVLRLPP
LGVAMFVRVD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggacccggacttggccagggtggctcccgagtcgctgcagtccttgctgcaggcgagc
catgccgatcccttcgcgctgctcggcgcacatccggtcgcgggcggaatggtgctgcgc
acgctgctgcccggtgcgcaggcggtcgtggtgctcgacatcgacggccgtccgctgctc
gagctccagcctcaggacggatcgccgctcttcatcggcgcgctcccgggaggctcgcat
ccgctgcgctaccgactgcacgtacgctggtccggtggcggcgagacgcgcttcgacgac
gcctaccgcttcggcgcgctgatcgaggatctcgacgtctggctgctcgccgaaggcagc
catcaccgcccctacgagtggctcggcgcgcaccctgtgaccgtcgacggcgtcgccggc
acgcgcttcgcggtgtgggcgcccaacgcgcgccgggtttctgtggtgggcggcttcaac
gcctgggacgggcgccgccacatgatgcggcatcgccgcgagtgcggcgtgtgggagatc
ttcctgcccggcatcggcgagggcgagctctacaagtacgagatcctcggcgccgacggc
gtcgtgcgcctcaaggccgaccccttcgccttccgcgccgagctgcgcccgcacaccgcc
tcggtggtgcagcgcctgctgcccgggctggcgatcgacgaagcgcgccggcgcgccaac
gcgctcgacgcgccgatcagcatctacgaggtccacctcggctcctggcagcgcaaggaa
gacggcggctggctgtcctaccgcgagctcgccgagcgcctggtgccctacgcggtcggg
ctcggcttcacccacctcgagctgctgccggtgcacgagcaccccttcgacggctcctgg
ggctaccagcccaccgggctgtacgcgccgagcgcgcgcttcggcacaccggaggatttc
cgcgccttcaccgatgccgcgcgcgccgccgggctgggggtgatcctcgactgggtgccg
gcacactttccgagcgatgcccatggcctggccgagttcgacggtacccatctgtacgag
cacgccgacccgcgcgagggcttccaccaggactggaacacgctgatctacaactacggc
cgcgccgaggtgcgcaactacctcgccagcaacgcgctgtactggatcgagcgcttcggc
gccgacgggctgcgggtggatgcggtggcctcgatgctgtatcgcgactacagccggcgc
gagggcgagtgggtgccgaaccgcttcggcgggcgcgagaacctggaggcgatcgacttc
ctgcgtcgcatgaaccacctcgtcggcacgcagcgccccgaggcgatcacgctcgccgag
gaatccaccgccttccccgccgtcagccgcccgccctcacccgacctgcagggcggcggc
ctgggcttccactacaagtggaacatgggctggatgaacgacctcctcgcctacctcgcg
cgcgacccggtgcatcgcaagcaccaccacgaccagctgcgcttctcgctggcgtatgcc
ttcagcgagaacttcgtgctgccgctgtcgcacgacgaggtggtgcacggcaagggctcg
ctgctcgccaagatgcccggcgacgtctggcagaagttcgccaacctgcgcctgctctac
ggctacatgtgggcgcacccgggcaagaagctgctcttcatgggttgcgagttcgccccg
tggtccgaatggaacgccgacgccagcctgccctgggagctgctcgggcacgccccgcac
gcgggcatgcagcgcctggtgcgcgatctcaaccgcgtgctgcgcagccatccggcactg
tacgagcaggacacggcgagcgaaggcttccgctggatctcccacgacgatgcggcgcac
tcggtgctggtcttcgagcgccgcgcgcgcgacggccgcagcgtggtggtcgcgtgcaac
ttcaccccggtggcgcgcgagggctggcgcaccggcatacccgcggcgggcacttggcgc
gagcttctcaacaccgacgatccggtgtatgggggctcgggcgtcaccaatggcgcgctg
cgaagcgaggcactgccctggcagggcgaggcacagtcgatcgtgctgcgcctgccgccg
ctgggcgtggcgatgttcgtacgcgtggactga

DBGET integrated database retrieval system