KEGG   Thauera sp. MZ1T: Tmz1t_2046Help
Entry
Tmz1t_2046        CDS       T00804                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tmz  Thauera sp. MZ1T
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tmz1t_2046
Enzymes [BR:tmz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Tmz1t_2046
Exosome [BR:tmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tmz1t_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2312915..2315107)
Genome map
AA seq 730 aa AA seqDB search
MDPDLARVAPESLQSLLQASHADPFALLGAHPVAGGMVLRTLLPGAQAVVVLDIDGRPLL
ELQPQDGSPLFIGALPGGSHPLRYRLHVRWSGGGETRFDDAYRFGALIEDLDVWLLAEGS
HHRPYEWLGAHPVTVDGVAGTRFAVWAPNARRVSVVGGFNAWDGRRHMMRHRRECGVWEI
FLPGIGEGELYKYEILGADGVVRLKADPFAFRAELRPHTASVVQRLLPGLAIDEARRRAN
ALDAPISIYEVHLGSWQRKEDGGWLSYRELAERLVPYAVGLGFTHLELLPVHEHPFDGSW
GYQPTGLYAPSARFGTPEDFRAFTDAARAAGLGVILDWVPAHFPSDAHGLAEFDGTHLYE
HADPREGFHQDWNTLIYNYGRAEVRNYLASNALYWIERFGADGLRVDAVASMLYRDYSRR
EGEWVPNRFGGRENLEAIDFLRRMNHLVGTQRPEAITLAEESTAFPAVSRPPSPDLQGGG
LGFHYKWNMGWMNDLLAYLARDPVHRKHHHDQLRFSLAYAFSENFVLPLSHDEVVHGKGS
LLAKMPGDVWQKFANLRLLYGYMWAHPGKKLLFMGCEFAPWSEWNADASLPWELLGHAPH
AGMQRLVRDLNRVLRSHPALYEQDTASEGFRWISHDDAAHSVLVFERRARDGRSVVVACN
FTPVAREGWRTGIPAAGTWRELLNTDDPVYGGSGVTNGALRSEALPWQGEAQSIVLRLPP
LGVAMFVRVD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggacccggacttggccagggtggctcccgagtcgctgcagtccttgctgcaggcgagc
catgccgatcccttcgcgctgctcggcgcacatccggtcgcgggcggaatggtgctgcgc
acgctgctgcccggtgcgcaggcggtcgtggtgctcgacatcgacggccgtccgctgctc
gagctccagcctcaggacggatcgccgctcttcatcggcgcgctcccgggaggctcgcat
ccgctgcgctaccgactgcacgtacgctggtccggtggcggcgagacgcgcttcgacgac
gcctaccgcttcggcgcgctgatcgaggatctcgacgtctggctgctcgccgaaggcagc
catcaccgcccctacgagtggctcggcgcgcaccctgtgaccgtcgacggcgtcgccggc
acgcgcttcgcggtgtgggcgcccaacgcgcgccgggtttctgtggtgggcggcttcaac
gcctgggacgggcgccgccacatgatgcggcatcgccgcgagtgcggcgtgtgggagatc
ttcctgcccggcatcggcgagggcgagctctacaagtacgagatcctcggcgccgacggc
gtcgtgcgcctcaaggccgaccccttcgccttccgcgccgagctgcgcccgcacaccgcc
tcggtggtgcagcgcctgctgcccgggctggcgatcgacgaagcgcgccggcgcgccaac
gcgctcgacgcgccgatcagcatctacgaggtccacctcggctcctggcagcgcaaggaa
gacggcggctggctgtcctaccgcgagctcgccgagcgcctggtgccctacgcggtcggg
ctcggcttcacccacctcgagctgctgccggtgcacgagcaccccttcgacggctcctgg
ggctaccagcccaccgggctgtacgcgccgagcgcgcgcttcggcacaccggaggatttc
cgcgccttcaccgatgccgcgcgcgccgccgggctgggggtgatcctcgactgggtgccg
gcacactttccgagcgatgcccatggcctggccgagttcgacggtacccatctgtacgag
cacgccgacccgcgcgagggcttccaccaggactggaacacgctgatctacaactacggc
cgcgccgaggtgcgcaactacctcgccagcaacgcgctgtactggatcgagcgcttcggc
gccgacgggctgcgggtggatgcggtggcctcgatgctgtatcgcgactacagccggcgc
gagggcgagtgggtgccgaaccgcttcggcgggcgcgagaacctggaggcgatcgacttc
ctgcgtcgcatgaaccacctcgtcggcacgcagcgccccgaggcgatcacgctcgccgag
gaatccaccgccttccccgccgtcagccgcccgccctcacccgacctgcagggcggcggc
ctgggcttccactacaagtggaacatgggctggatgaacgacctcctcgcctacctcgcg
cgcgacccggtgcatcgcaagcaccaccacgaccagctgcgcttctcgctggcgtatgcc
ttcagcgagaacttcgtgctgccgctgtcgcacgacgaggtggtgcacggcaagggctcg
ctgctcgccaagatgcccggcgacgtctggcagaagttcgccaacctgcgcctgctctac
ggctacatgtgggcgcacccgggcaagaagctgctcttcatgggttgcgagttcgccccg
tggtccgaatggaacgccgacgccagcctgccctgggagctgctcgggcacgccccgcac
gcgggcatgcagcgcctggtgcgcgatctcaaccgcgtgctgcgcagccatccggcactg
tacgagcaggacacggcgagcgaaggcttccgctggatctcccacgacgatgcggcgcac
tcggtgctggtcttcgagcgccgcgcgcgcgacggccgcagcgtggtggtcgcgtgcaac
ttcaccccggtggcgcgcgagggctggcgcaccggcatacccgcggcgggcacttggcgc
gagcttctcaacaccgacgatccggtgtatgggggctcgggcgtcaccaatggcgcgctg
cgaagcgaggcactgccctggcagggcgaggcacagtcgatcgtgctgcgcctgccgccg
ctgggcgtggcgatgttcgtacgcgtggactga

DBGET integrated database retrieval system