KEGG   Thauera sp. MZ1T: Tmz1t_2047Help
Entry
Tmz1t_2047        CDS       T00804                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmz1t_2047 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmz1t_2047 (glk)
   00052 Galactose metabolism
    Tmz1t_2047 (glk)
   00500 Starch and sucrose metabolism
    Tmz1t_2047 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Tmz1t_2047 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tmz1t_2047 (glk)
   00524 Butirosin and neomycin biosynthesis
    Tmz1t_2047 (glk)
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tmz1t_2047 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2315987..2317006)
Genome map
AA seq 339 aa AA seqDB search
MNATPAPYPRLVADIGGTNARFALVEAPGAAPTHLRALRCAEHSGPEAALRAWLADTGAR
LPAYAAFGIATPIDGDGVAMTNHPWRFSIGALCGALGLRRLTVVNDFTALALALPALGDG
DLVRVGGGEPRAGAARALIGAGTGLGVSGLLPVPGGWVPLQGEGGHVTLPASCTREAAVV
AWLAARHGHVSAERVLSGPGLVVLHDTLRALDGEARVERTPAEISERALAGGCRHCVEAL
ELFCALLGTVAGDVALTLGARGGLYIGGGIVPRLGDFFLRSAFRERFVAKGRFRPWLERI
PIWVVVAPHAALTGASAALDSAIELGFTTLAEPRGHVSP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacccctgctccctatccccgcctggtcgccgacatcggcggcaccaacgcg
cgcttcgccctcgtcgaggcgcccggagcggcaccgacgcatctgcgagcgctgcgctgc
gcggaacacagcggcccggaggccgcgttgcgcgcctggttggcggacaccggcgcccgc
ctgcccgcttacgccgccttcggcatcgccacgccgatcgacggcgacggcgtcgcgatg
accaatcatccctggcgcttttcgatcggcgcgctgtgcggcgcgctcggcctgcgccgg
ctgaccgtggtgaacgatttcaccgcgctcgcgctcgcgctgcccgcgctcggcgacggc
gacctggtccgcgtcggcggcggcgagccgcgtgcgggcgccgcgcgggcgttgatcggc
gccggcaccgggctcggcgtttcgggcctgctgcccgtgccgggcggctgggtcccgctg
caaggcgagggcgggcacgtgacgctgccggcctcttgcacacgcgaggccgcggtggtc
gcctggctcgccgcccgccatggccatgtctcggccgagcgcgtgctctcgggtcccggt
ctggtcgtgctccacgacaccttgcgcgcgctcgacggcgaagcgcgtgtcgagcgcacg
ccggcggagatcagcgaacgggcgctggccggcggctgccgccactgcgtcgaggcactc
gagctcttctgcgcgctgctcggcacggtggcgggcgacgtcgcgctcaccctgggcgcg
cgcggcgggctgtatatcggcggtggcatcgtgccgcggctgggggatttcttcctgcgc
tccgcgttccgcgaacgtttcgtcgccaagggccgctttcgcccctggctcgaacgcatc
ccgatctgggtggtcgtcgccccccacgccgccctcaccggcgcctcggcggcactcgac
agcgccatcgagctcggcttcaccacgctcgccgagccgcgcgggcacgtctccccgtag

DBGET integrated database retrieval system