KEGG   Thauera sp. MZ1T: Tmz1t_2047Help
Entry
Tmz1t_2047        CDS       T00804                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00010  Glycolysis / Gluconeogenesis
tmz00052  Galactose metabolism
tmz00500  Starch and sucrose metabolism
tmz00520  Amino sugar and nucleotide sugar metabolism
tmz00521  Streptomycin biosynthesis
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
tmz01200  Carbon metabolism
Module
tmz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmz1t_2047
   00052 Galactose metabolism
    Tmz1t_2047
   00500 Starch and sucrose metabolism
    Tmz1t_2047
   00520 Amino sugar and nucleotide sugar metabolism
    Tmz1t_2047
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tmz1t_2047
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tmz1t_2047
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tmz1t_2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACK54795
JGI: Tmz1t_2047
UniProt: C4ZP37
Position
complement(2315987..2317006)
Genome map
AA seq 339 aa AA seqDB search
MNATPAPYPRLVADIGGTNARFALVEAPGAAPTHLRALRCAEHSGPEAALRAWLADTGAR
LPAYAAFGIATPIDGDGVAMTNHPWRFSIGALCGALGLRRLTVVNDFTALALALPALGDG
DLVRVGGGEPRAGAARALIGAGTGLGVSGLLPVPGGWVPLQGEGGHVTLPASCTREAAVV
AWLAARHGHVSAERVLSGPGLVVLHDTLRALDGEARVERTPAEISERALAGGCRHCVEAL
ELFCALLGTVAGDVALTLGARGGLYIGGGIVPRLGDFFLRSAFRERFVAKGRFRPWLERI
PIWVVVAPHAALTGASAALDSAIELGFTTLAEPRGHVSP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacccctgctccctatccccgcctggtcgccgacatcggcggcaccaacgcg
cgcttcgccctcgtcgaggcgcccggagcggcaccgacgcatctgcgagcgctgcgctgc
gcggaacacagcggcccggaggccgcgttgcgcgcctggttggcggacaccggcgcccgc
ctgcccgcttacgccgccttcggcatcgccacgccgatcgacggcgacggcgtcgcgatg
accaatcatccctggcgcttttcgatcggcgcgctgtgcggcgcgctcggcctgcgccgg
ctgaccgtggtgaacgatttcaccgcgctcgcgctcgcgctgcccgcgctcggcgacggc
gacctggtccgcgtcggcggcggcgagccgcgtgcgggcgccgcgcgggcgttgatcggc
gccggcaccgggctcggcgtttcgggcctgctgcccgtgccgggcggctgggtcccgctg
caaggcgagggcgggcacgtgacgctgccggcctcttgcacacgcgaggccgcggtggtc
gcctggctcgccgcccgccatggccatgtctcggccgagcgcgtgctctcgggtcccggt
ctggtcgtgctccacgacaccttgcgcgcgctcgacggcgaagcgcgtgtcgagcgcacg
ccggcggagatcagcgaacgggcgctggccggcggctgccgccactgcgtcgaggcactc
gagctcttctgcgcgctgctcggcacggtggcgggcgacgtcgcgctcaccctgggcgcg
cgcggcgggctgtatatcggcggtggcatcgtgccgcggctgggggatttcttcctgcgc
tccgcgttccgcgaacgtttcgtcgccaagggccgctttcgcccctggctcgaacgcatc
ccgatctgggtggtcgtcgccccccacgccgccctcaccggcgcctcggcggcactcgac
agcgccatcgagctcggcttcaccacgctcgccgagccgcgcgggcacgtctccccgtag

DBGET integrated database retrieval system