KEGG   Thauera sp. MZ1T: Tmz1t_2078Help
Entry
Tmz1t_2078        CDS       T00804                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00362  Benzoate degradation
tmz00620  Pyruvate metabolism
tmz00621  Dioxin degradation
tmz00622  Xylene degradation
tmz00650  Butanoate metabolism
tmz01100  Metabolic pathways
tmz01120  Microbial metabolism in diverse environments
tmz01220  Degradation of aromatic compounds
Module
tmz_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmz1t_2078
   00650 Butanoate metabolism
    Tmz1t_2078
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tmz1t_2078
   00622 Xylene degradation
    Tmz1t_2078
   00621 Dioxin degradation
    Tmz1t_2078
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tmz1t_2078
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Tmz1t_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACK54819
JGI: Tmz1t_2078
UniProt: C4ZPH3
Position
2352285..2353208
Genome map
AA seq 307 aa AA seqDB search
MNKIKCALIGPGNIGTDLLYKLKRSPVLEPVWMVGIDATSEGLARAREMGLKTTAEGVDG
LLPHVVADGVQIAFDATSAYVHAENSRKLNELGVLMIDLTPAAIGPFCVPPVNLAEHVGK
GEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSKSAGPGTRKNIDEFTRTTAGA
VEKVGGAKKGKAIIILNPAEPPLIMRDTVHCLTETEPDQAAITESIHAMIREVQKYVPGY
RLVNGPVFDGNRVSVFLEVEGLGDYLPKYAGNLDIMTAAGARTAEMFAEEILAGRLKLES
NRATMVA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcaaatgcgccctgatcggtccgggcaacatcggcaccgacctgctgtac
aagttgaagcgtagcccggtgctggagccggtgtggatggtgggcatcgacgccacctcc
gaaggcctggcgcgtgcgcgcgagatgggcctcaagactaccgccgagggcgtcgacggc
ctgctgccgcatgtggtcgctgacggcgtgcagatcgccttcgacgccacctcggcctat
gtccatgccgagaacagccgcaagctgaacgagctgggcgtgctgatgatcgacctcacc
cccgcggcgatcggcccgttctgcgtgccgccggtcaatctcgccgagcacgtcggcaag
ggcgagatgaacgtgaacatggtcacctgcggcggccaggccacgatcccgatggtcgca
gcggtgtcgcgcgtgcagccggtggcctatggcgagatcgtcgccaccgtgtcgagcaaa
tcggccggtccgggcacgcgcaagaacatcgacgaattcacccgtaccactgccggtgcg
gtcgagaaggtgggcggcgccaagaagggcaaggccatcatcatcctgaacccggccgag
ccgccgctgatcatgcgcgacacggtgcactgcctgaccgagaccgagcccgaccaggcc
gcgatcaccgaatccatccacgccatgatccgcgaagtgcagaagtacgtccccggctac
cgcctcgtgaacggcccggtgttcgacggcaaccgcgtctcggtcttcctggaagtcgaa
ggcctgggcgactacctgcccaagtacgccggcaacctcgacatcatgaccgcggccggt
gcgcgcaccgccgagatgttcgccgaggagatcctcgccgggcgcctgaaactcgaatcc
aaccgcgccacgatggtggcctga

DBGET integrated database retrieval system