KEGG   Thauera sp. MZ1T: Tmz1t_2189Help
Entry
Tmz1t_2189        CDS       T00804                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00040  Pentose and glucuronate interconversions
tmz00052  Galactose metabolism
tmz00500  Starch and sucrose metabolism
tmz00520  Amino sugar and nucleotide sugar metabolism
tmz01100  Metabolic pathways
tmz01130  Biosynthesis of antibiotics
Module
tmz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tmz1t_2189
   00052 Galactose metabolism
    Tmz1t_2189
   00500 Starch and sucrose metabolism
    Tmz1t_2189
   00520 Amino sugar and nucleotide sugar metabolism
    Tmz1t_2189
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tmz1t_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACK54929
JGI: Tmz1t_2189
UniProt: C4ZJT8
Position
complement(2468308..2469213)
Genome map
AA seq 301 aa AA seqDB search
MKKVTKAIFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVAAGITDMIFITGRT
KRSIEDHFDKAYELETELEARGKKQLLEIVRQTVPKGVNCIYIRQSEALGLGHAVRCASH
VVSDEAFAVILADDLLDNKDGTPVLKQMVDVYNYHRCSVLGTMNVPREETRSYGIVSTES
DKGQVQRMTGIVEKPKPEEAPTTQAVVGRYILTPRIFDHIRALKPGAGGEYQLTDAIASL
LKEEAVLAFQFDGVRYDCGSKLGYLKATIEFGLRHPETGGDFAAYLSGRFGAEGKAAKAA
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtcaccaaggcgatttttcctgtggccggcatgggcacgcgcttcctgccc
gccaccaaggcgagcccgaaggagatgctgccgatcgtcgacaagcccttgatccagtac
gccgttgaagaggcggtcgccgccggcatcaccgacatgatcttcatcaccggtcgtacc
aagcgctcgatcgaggaccacttcgacaaggcctacgagctcgagaccgagctcgaggcg
cgcggcaagaagcagctgctcgagatcgtgcgccagacggtgccgaagggcgtcaactgt
atctacatccgccagtccgaggcgctcggcctcggccatgccgtgcgttgcgccagccac
gtggtgagcgacgaggccttcgcggtgatcctcgccgacgacctgctcgacaacaaggat
ggcacgccggtgttgaagcagatggtggatgtgtacaactatcaccgctgctcggtgctc
ggcacgatgaatgtgccgcgcgaggaaacccgcagctacggcatcgtcagcaccgaatcc
gacaagggccaggtgcagcgcatgaccggcatcgtcgagaagcccaagcccgaggaagca
ccgacgacccaggccgtggtcggtcgctacatcctgaccccgcgcatcttcgatcacatc
cgtgcgttgaagcccggcgccggtggcgagtaccagctcaccgacgcgatcgcatcgctg
ctcaaggaggaggccgtgctggccttccagttcgacggcgtgcgctacgactgcggttcg
aagctcggctacctgaaggcgacgatcgagttcgggttgcgccatccggaaactggtggc
gacttcgcggcctacctgagcgggcgcttcggcgccgaaggcaaggcggcgaaggcagcc
aagtaa

DBGET integrated database retrieval system