KEGG   Thauera sp. MZ1T: Tmz1t_2242Help
Entry
Tmz1t_2242        CDS       T00804                                 

Definition
Arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tmz  Thauera sp. MZ1T
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tmz1t_2242
Enzymes [BR:tmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Tmz1t_2242
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Tmz1t_2242
Lipid biosynthesis proteins [BR:tmz01004]
 Fatty acid synthase
  Component type
   Tmz1t_2242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2525618..2526220
Genome map
AA seq 200 aa AA seqDB search
MFLFGAVARADTILVWGDSLSAGYGLERGQEWPTLLQTRLQAEGFRHVVVNASVSGETSS
GGLTRLPAALAEHAPTLVILELGANDGLRGLKPQLLADNLAAMIDAADAAGARVLLIGMR
MPPNYGPAYTQRFAEVFANVAAEKKVPLVPFLMDGFADRPELFLPDGIHPAAEAQPRIVD
TVWAGLRPLLAAKETKAARK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttccttttcggcgccgtcgcccgcgccgacaccatcctggtatggggcgacagcctg
tcggccggctacggtctggaaaggggccaggaatggcccaccctgttgcagacgcgtctg
caggccgaagggttccgccatgtcgtggtcaacgccagtgtatccggcgagacctcgtcg
ggtggcctcacccgcctgcccgccgccctggccgaacatgcgcccacgctggtgatcctg
gagctcggcgccaacgacggcctgcgcggactcaagccgcagctgctcgcggacaacctg
gccgcgatgatcgacgctgcggacgcggcgggcgcgcgcgtcctgctgatcggcatgcgc
atgccgccaaactatggtccggcctacacgcaacgcttcgcagaggtcttcgccaacgtg
gccgcggagaagaaggtgccgctcgtgcccttcctgatggacggcttcgccgaccgcccc
gagctcttcctgcccgacggcatccacccggccgccgaggcgcagccgcgcatcgtcgac
acggtatgggccggccttcgcccgctgcttgccgcgaaggagacgaaggcagcgcgcaag
tga

DBGET integrated database retrieval system