KEGG   Thauera sp. MZ1T: Tmz1t_2296Help
Entry
Tmz1t_2296        CDS       T00804                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tmz1t_2296
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmz1t_2296
  Lipid metabolism
   00071 Fatty acid degradation
    Tmz1t_2296
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tmz1t_2296
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tmz1t_2296
   00626 Naphthalene degradation
    Tmz1t_2296
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tmz1t_2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2582572..2583609
Genome map
AA seq 345 aa AA seqDB search
MPQPHPNAPAKPPAGMRAMQLERPGEALRAVHLAVPRPGPGQVLLRVEACGVCRTDLHLI
DGELPDPVLPMIPGHEIIGRVVELGEGVGDAAGMVPGQRIGVPWLGWTCGHCGFCASQRE
NLCDAARFTGYQIQGGYAEYTVADARYCFPIDEALDAAEAAPLLCAGLIGYRALEMAGAA
RRIGLYGFGAAAHIITQVAVWQGREVYAFTRPGDSASQAFARRLGACWTGAGEERPPHPL
DAALIFAPSGELVPAALRAVAKGGTVVCAGIHMSTIPAFPYDILWGERRIVSVANLTRRD
GDEFLALAPRVPVRTEVVRFALEDANEALERLRRGALQGAAVLLP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccccagccccatccgaacgcccccgccaagccccccgccggcatgcgcgcgatgcaa
ctcgaacgccccggcgaggccctgcgcgcggtgcatctggcggtgccgcgccccggcccc
gggcaggtgctgctgcgggtggaggcctgcggcgtgtgccgcaccgatctccacctcatc
gacggcgagctgcccgacccggtgctgccgatgattcccggccacgagatcatcggccgc
gtggtcgaactgggcgaaggcgtcggcgacgccgcgggcatggtgccgggtcagcgcatc
ggcgtgccctggctggggtggacctgcgggcattgcggcttctgcgccagccagcgcgag
aacctctgcgacgcggcgcgcttcaccggctaccagatccagggcggttatgccgaatac
accgtggccgacgcacgctactgcttcccgatcgacgaggcgctcgacgccgccgaggcc
gcgccgctgctgtgcgccggcctgatcggctatcgtgcgctggagatggcgggcgccgcg
cgccgcatcggcctctacggcttcggcgcggccgcccacatcatcacccaggtggcggtg
tggcagggtcgcgaggtgtacgccttcacccgtcccggcgacagcgcaagccaggccttc
gcccgccggctcggcgcctgctggacgggcgcgggcgaagagcgccccccgcacccgctc
gacgccgcgctgatcttcgccccctccggcgagctcgtccccgccgcgctgcgcgccgtc
gccaagggtggcacggtggtgtgcgcgggcatccacatgagcaccatccccgccttcccc
tacgacatcctgtggggcgagcgccgcatcgtctcggtcgccaacctcacccgccgcgac
ggcgacgaattcctcgccctcgcgcccagggtgccggtacgcaccgaggtcgtccgcttc
gccctcgaggacgccaacgaggcgctcgagcgcctgcgccgcggcgcgctgcagggggcg
gcggtgctgctgccctga

DBGET integrated database retrieval system