KEGG   Thauera sp. MZ1T: Tmz1t_2307Help
Entry
Tmz1t_2307        CDS       T00804                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00520  Amino sugar and nucleotide sugar metabolism
tmz01100  Metabolic pathways
tmz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tmz1t_2307
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Tmz1t_2307
Enzymes [BR:tmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tmz1t_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 OB_RNB
Motif
Other DBs
NCBI-ProteinID: ACK55046
JGI: Tmz1t_2307
UniProt: C4ZK55
Position
complement(2599321..2600466)
Genome map
AA seq 381 aa AA seqDB search
MNPPIRRPRGPVMIDVAGTALTDEERERLRDPLVGGVILFARNYTGSEQLRALTAEIRGL
RDPALIIAVDHEGGRVQRFRTDGFTRLPSMRSLGALWAQDHLVALDAARATGVVLAAELR
AHGVDLSFTPVLDLDYGCCRAIGNRAFHRDPQVVAALAQALCAGMAEAGMGCVGKHFPGH
GFVEADSHHDVPVDERDFDTVWNEDIAPYRHRLGRQLAGVMPAHVVYPNADPSPEPQPAG
FSPFWLKEVLRDRLGFQWVIFSDDLNMEGARVAGDIVGRAKAAYAAGCDMLLVCNRPDLA
AELLDRWAPDLDAGNLARLAAILPDTARPAWLADPFALELHAPYLRAREHLASIPEDKSA
APTMTAATIGEQRTEVLRKEG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacccatccgccgcccacgcggccccgtcatgatcgatgtcgccggcaccgcg
ctcaccgacgaggagcgcgaacgcctgcgcgaccctctggtcggcggggtgatcctgttc
gcgcgcaactacaccggctccgagcagctgcgcgcgctcaccgccgagatccgcgggctg
cgcgacccggcgctgatcatcgcggtcgaccacgaaggcggcagggtgcagcgcttccgc
accgacggcttcacccgcctgccgtcgatgcgcagcctcggcgccttgtgggcgcaggac
catctggtggcgctcgacgcggcgcgcgccaccggcgtcgtgctcgccgccgagctgcgc
gcgcacggggtcgacctgagcttcaccccggtgctggatctcgactacggctgctgccgc
gcgatcggcaaccgcgccttccatcgcgatccgcaggtggtcgcggcgctcgcgcaggcg
ctgtgcgccggcatggcggaggcgggcatgggctgcgtgggcaagcacttccccggccac
ggcttcgtcgaggccgactcgcaccacgacgtgccggtggacgagcgcgacttcgacacg
gtttggaacgaggacatcgccccctaccgccatcgtctcggccgccagctcgccggcgtc
atgcccgcccacgtcgtctaccccaacgccgaccccagccccgaaccgcagcccgcaggc
ttctcgccgttctggctgaaggaggtgctgcgcgaccgcctcggcttccagtgggtgatc
ttcagcgacgatctcaacatggaaggcgcccgcgtcgccggtgacatcgtcggccgtgcg
aaagcagcctacgcggccggctgcgacatgctgctggtgtgcaatcgacctgacctcgcg
gccgagctgctggatcgctgggcgccggacctggacgccggcaacctggcccgactcgcc
gcgatcttgccggacacggccaggccagcctggcttgccgaccccttcgcactcgaactg
cacgccccctacctccgggcccgcgagcacctcgcgtccattcccgaggacaagagcgcc
gcgccaaccatgaccgccgccaccatcggtgagcaacgtaccgaagtcctgcgcaaggaa
ggataa

DBGET integrated database retrieval system