KEGG   Thauera sp. MZ1T: Tmz1t_2515Help
Entry
Tmz1t_2515        CDS       T00804                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tmz00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tmz00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2716089..2716646
Genome map
AA seq 185 aa AA seqDB search
MSFARLARALAPAVLLATLAPNAGAADDATTRLYDHSLRRLHADESVRLADRYAGQPVLV
VNTASHCGFTRQFRELEAVHQRYKARGLKVAGFPSDDFRQEAADEAETAEVCFQNFGVTF
DMYAPIHVTGTEAHPLFREIARQSAAPEWNFHKYVIDRNGRVVAAFGSRTKPDAPEVIAA
IEKAL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgcccgtcttgcccgtgccctcgcccccgccgttctgctcgccaccctcgcc
cccaacgccggcgctgccgacgatgcgacgacgcgcctctacgaccacagcctgcgccgt
ctgcacgccgacgagtcggtgcggctcgcagaccgctacgccggccagcccgtgctggtg
gtcaacaccgccagccactgcggcttcacgcggcagttccgcgagctcgaggcggtgcac
cagcgctacaaggcgcgcgggctcaaggtcgccggctttccgtccgacgacttccgccag
gaggctgccgacgaggccgagaccgccgaggtctgcttccagaacttcggcgtcaccttc
gacatgtacgcgccgatccacgtcaccggcaccgaagcgcatcccttgttccgcgagatc
gcacgccagtcggcggcgccggagtggaacttccacaagtacgtgatcgaccgcaacggc
cgcgtggtggcggccttcggcagccgcaccaagcccgacgcccccgaggtgatcgcggca
atcgagaaggcgctgtga

DBGET integrated database retrieval system