KEGG   Thauera sp. MZ1T: Tmz1t_2549Help
Entry
Tmz1t_2549        CDS       T00804                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tmz  Thauera sp. MZ1T
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmz1t_2549
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tmz1t_2549
   00650 Butanoate metabolism
    Tmz1t_2549
  Energy metabolism
   00190 Oxidative phosphorylation
    Tmz1t_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2751064..2751414)
Genome map
AA seq 116 aa AA seqDB search
MVKQRIVVGAHYGLKDWIAQRATAVYMAAYTIIFALCAFSLRELNYQEWSGLFSHGLFKF
LSFLFFLSVFYHAWIGIRDLWMDYIKPNGVRLALHLVTIFVLVGYAGWAAQILWRL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacagcgtatcgtcgtcggcgcgcactacggtctgaaggactggatcgcgcaa
cgcgccactgccgtctacatggcggcctacaccatcatcttcgcgctctgtgcgttcagc
ctgcgcgagctcaactaccaggaatggtccggcctgttctcgcacggcttgttcaagttc
ctcagcttcctgttcttcctgtcggtcttctatcacgcctggatcggcatccgcgacctc
tggatggactacatcaagccgaacggtgtgcgcctcgcgctgcacctggtcaccattttc
gtgctcgtcggctatgccggctgggcagcccagatcctgtggaggctttaa

DBGET integrated database retrieval system