KEGG   Thauera sp. MZ1T: Tmz1t_2573Help
Entry
Tmz1t_2573        CDS       T00804                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmz1t_2573
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmz1t_2573
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tmz1t_2573
Enzymes [BR:tmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tmz1t_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2778737..2780200)
Genome map
AA seq 487 aa AA seqDB search
MKYLSTRGHAGQPANPEFCDILLGGLAPDGGLYLPETYPQVTRAELDAWRGLSYAELAFA
ILSKFITDIPAVDLKAICAKTYTAEVYRHVRAGGDARDITPVHWLEKDADGRGRLGLLEL
SNGPTLAFKDMAMQLLGNLFEYVLAKRGETINILGATSGDTGSAAEYAMRGKHGVRVFML
SPHGKMSAFQRAQMYSLQDDNIFNIAVTGMFDDAQDIVKAVSNDHAFKARHKIGAVNSIN
WARVAAQIVYYFKGYFAATTSNDEQVAFCVPSGNFGNICAGHIARQMGLPVAKLILATNE
NDVLDEFFRSGVYRPRKAAETHVTSSPSMDISKASNFERFVFDLVGRDPSKVAALWAEVD
AGRAFDLSGTDEFARIGAFGFVSGASSHADRLATIRKVYERYGVMIDTHTADGVKVAWER
AADVPAGVPVLVLETALPVKFAETIVEALGREPERPADLEGIEKLPQRVEVMAPDADAIK
RFIAQRT
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatctctccacccgcggccacgccggccagcccgccaacccggagttctgcgac
atcctgctcggcggcctcgcccccgacggcggcctctacctgcccgagacctatccgcag
gtgacgcgcgccgagctcgacgcctggcgcggcctgtcctacgcagagctggcgttcgcg
atcctgtcgaagttcatcaccgacatccccgccgtcgacctgaaggcgatctgcgccaag
acctacaccgccgaggtctatcgccacgtgcgcgcgggcggcgacgcgcgcgacatcact
ccggtgcactggctggagaaggatgccgacggccgcggccgcctcggcctgctcgagctg
tccaatggcccgacgctggccttcaaggacatggccatgcagctgctcggcaacctcttc
gaatacgtgctcgcgaagcgtggcgagaccatcaacatcctcggtgccacctcgggcgat
accggctcggcggccgagtacgcgatgcgcggcaagcacggcgtgcgtgtgttcatgctg
tcgccgcacggcaagatgagcgccttccagcgcgcgcagatgtattcgctgcaggacgac
aacatcttcaacatcgccgtcaccggcatgttcgacgatgcccaggacatcgtgaaggcg
gtctccaacgatcacgccttcaaggccaggcacaagatcggtgcagtgaattcgatcaac
tgggcgcgggtcgcggcgcagatcgtgtattacttcaagggctacttcgcggccacgacg
agcaacgacgagcaggtcgccttctgcgtgccctcgggcaacttcggcaacatctgcgcc
ggccacatcgcccgccagatgggcctgccggtggcgaagctgatcctcgccaccaacgag
aacgacgtgctcgacgagttcttccgcagcggcgtgtatcgcccgcgcaaggcggccgag
acgcacgtgacctccagcccgtcgatggacatctccaaggcctcgaacttcgagcgcttc
gtcttcgacctggtcggccgcgacccgagcaaggtggccgcgctgtgggccgaggtcgac
gccgggcgcgccttcgacctgtccggcacggacgaattcgcccgcatcggcgcgttcggc
ttcgtgtctggcgcgagcagccatgccgatcgcctggcgaccatccgcaaggtgtacgag
cgctacggcgtgatgatcgacacccacaccgccgacggcgtcaaggtggcctgggagcgc
gccgccgacgtacctgcgggcgtgccggtgctggtgctggagaccgcgctgccggtgaaa
ttcgccgagaccatcgtcgaggcccttgggcgcgagccggagcgtcccgcagacctcgaa
ggcatcgagaagctgccgcagcgcgtcgaggtgatggcgcccgacgccgacgcgatcaag
cgcttcatcgcccagcgcacctga

DBGET integrated database retrieval system