KEGG   Thauera sp. MZ1T: Tmz1t_2726Help
Entry
Tmz1t_2726        CDS       T00804                                 

Definition
cation diffusion facilitator family transporter
Organism
tmz  Thauera sp. MZ1T
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2951932..2952951)
Genome map
AA seq 339 aa AA seqDB search
MHTENLSAWTHDHVFDTGNALAERSTRVVMWITAAAMVIEITAGWWFNSMALLADGWHMS
SHAFAIGVSALAYAAARRYAQDRRFAFGTWKIEILGGFASAIFLLGVAAMMVVGSIERIV
SPQAIQYREAIAVAILGLAVNLVCALILGRAHHHGHDHHHHGHGHGHSHGHGHEHRGHAH
DHPHHDLNLKSAYLHVIADAATSVLAIVALVGGWIYGWSWLDPVMGIVGAVLVAVWAKGL
LVETGRVLLDREMDHPVVAEIREAVESAPEAGETRITDLHVWRVGKAAYSCAVAVVTSDA
ALTPDAVRARLAEHEEIVHSTIEIHHHGGSRGALVEAAS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgagaacctgtccgcgtggacccacgaccacgtcttcgataccggcaacgcg
ctcgccgagcgcagcacgcgggtggtgatgtggatcaccgccgcggcgatggtgatcgag
atcaccgccggctggtggttcaattcgatggcgctgctggccgatggctggcacatgagc
tcgcacgccttcgcgatcggtgtttccgcgctggcctatgccgccgcgcggcgctacgcg
caggaccggcgcttcgccttcggcacgtggaagatcgagatcctgggcggcttcgccagc
gccatcttcctgctcggcgtggcggcgatgatggtcgtcggctcgatcgagcgcatcgtg
tcgccgcaagccatccagtaccgcgaggcgatcgcggtcgccatcctggggctggcggtc
aacctcgtgtgcgcgctgatcctgggcagggcgcaccatcacggtcacgaccatcaccac
cacggccacggtcacggccactcgcacggccatggtcacgagcatcgcggtcatgcccac
gatcacccccatcacgacctcaacctcaagtcggcctacctccacgtcatcgccgacgcg
gcgacctcggtgctggccatcgtcgcgctcgttggcggttggatctacggctggtcctgg
ctggatccggtgatgggcatcgtcggcgcggtgctggtcgccgtctgggccaagggcctg
ctggtcgagacgggccgggtgctgctcgatcgcgagatggatcacccggtcgtggccgag
atccgtgaagcggtcgaatccgcaccggaggcgggcgaaacccggatcaccgacctgcac
gtctggcgcgtcggcaaggcggcctactcgtgcgccgtcgcggtggtgacatccgatgcc
gcgctcacccccgacgccgtacgcgcccgcctggcggagcacgaggagatcgtgcactcc
acgatcgagatccatcaccatggcggttcccggggagcccttgtcgaggccgcttcgtga

DBGET integrated database retrieval system