KEGG   Thauera sp. MZ1T: Tmz1t_2763Help
Entry
Tmz1t_2763        CDS       T00804                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tmz  Thauera sp. MZ1T
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tmz1t_2763
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tmz1t_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2992167..2992673
Genome map
AA seq 168 aa AA seqDB search
MVRAYVAFGANLGDPAAAFFEAVQRLDALPGTRVVARSSLYRSAPVGVAGQPDYLNAVIA
LDTALAPRPLLEALLAIEHDSGRRRDFPMAPRTLDLDLLLYGDAVIDEPGLQVPHPRMHE
RAFALLPLAEIDPAASIPGRGAVAALLPALAGQAIERVPTPADSARHP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttggtccgcgcatacgtcgccttcggcgccaacctcggcgacccggccgccgcgttcttc
gaagccgtgcagcgcctcgatgcgctgcccggcacgcgcgtcgtcgcgcgctcctcgctg
taccgcagcgccccggtgggcgtggccggccagcccgactacctcaacgcggtgatcgcg
ctcgacaccgcgctcgcgccgcgcccgctgctggaggccctgctcgcgatcgagcacgac
agcggccgccgccgcgacttcccgatggcgccgcgcacgctggacctcgacctgctgctg
tacggcgacgcggtgatcgacgagcccggcctgcaggtgccccacccgcgcatgcacgag
cgcgccttcgcgttgctgccgctggccgagatcgatcccgccgccagcattcccggccgc
ggcgcggtcgcggcgctgctgcccgcgctcgccggccaggcgatcgaacgcgtgcccacc
cccgccgacagcgcccgccacccctga

DBGET integrated database retrieval system