KEGG   Thauera sp. MZ1T: Tmz1t_2788Help
Entry
Tmz1t_2788        CDS       T00804                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tmz  Thauera sp. MZ1T
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tmz00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tmz00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:tmz03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tmz03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tmz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3017868..3018308
Genome map
AA seq 146 aa AA seqDB search
MAPRVQFYHNTPDRLALAHELAAGAHARGRKVALRCTDATQLRRLDQALWTAVPLDFVPH
VGVGSALAAETPVVLGAAGEPCPWPHADMLFNLADDVPAEAEGFRMVVEIVGRDAAEVHA
ARLRWAAYRQRGYELKAFDAERRVAL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgcgtgcagttctatcacaacacccccgaccgcctcgcgctcgcgcacgag
ctggccgccggggcgcacgcacgcggccgcaaggtggcactgcgttgcaccgacgcgacc
cagttgcgccgactcgaccaggcgctatggaccgcggtgccgctcgacttcgtgccccac
gtcggcgtcgggtcggcgctggccgcggagaccccggtggtgctgggcgcagccggcgag
ccctgcccgtggccgcacgccgacatgctgttcaacctcgccgacgacgttcccgccgag
gcggaagggtttcgcatggtcgtcgagatcgtcggccgcgacgccgccgaagtgcacgcc
gcccgcctgcgctgggccgcctaccggcagcgcggttacgaactgaaggccttcgacgcc
gaacgcagggtggcgctgtga

DBGET integrated database retrieval system