KEGG   Thauera sp. MZ1T: Tmz1t_2962Help
Entry
Tmz1t_2962        CDS       T00804                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K18357  
phenylglyoxylate dehydrogenase gamma subunit [EC:1.2.1.58]
Organism
tmz  Thauera sp. MZ1T
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Tmz1t_2962
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     Tmz1t_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3205591..3206163
Genome map
AA seq 190 aa AA seqDB search
MYEVRIHGRGGQGAVLAAQLLATALVFDGKYAVSIPAFGFERRGAPVVSFIRASEQPIRQ
LTNIYAPDCIVCVDPALARTVNIFAGLKPGGTLVQATSRPLAEIDVPDSVGTVGLCDAVR
IATEIFGRPITNTLMLGAFARSTGQVSLEALKKVIEQSDFRDAGLRQNLDALERGYAETT
VHTLERRITA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaggtcaggatccatggtcgtggcgggcagggcgcggtgcttgcggcccagctg
ctcgcgaccgcactcgtgttcgacggcaagtacgccgtctccattcccgccttcggcttc
gagcgccgcggcgcgccggtggtgtccttcatccgcgcgagcgaacagccgatccgccag
ctcaccaacatctacgcacccgactgcatcgtctgcgtcgatcccgcgctcgcccgcacc
gtgaacatcttcgccggcctcaagcccggcggcaccctggtgcaggcgacctcgcgcccg
ctcgccgagatcgacgtgcccgacagcgtcggcaccgtcggcctgtgcgacgcggtgcgc
atcgccaccgagatcttcggccgcccgatcaccaacaccctgatgctcggcgccttcgcg
cgcagcaccggccaggtctcgctcgaggcgctgaagaaggtgatcgagcaatccgatttc
cgcgacgccggcctgcggcagaacctcgacgccctcgagcgcggctatgcggaaacgacc
gtgcacaccctcgaacggaggatcacagcatga

DBGET integrated database retrieval system