KEGG   Thauera sp. MZ1T: Tmz1t_2966Help
Entry
Tmz1t_2966        CDS       T00804                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K18356  
phenylglyoxylate dehydrogenase beta subunit [EC:1.2.1.58]
Organism
tmz  Thauera sp. MZ1T
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Tmz1t_2966
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     Tmz1t_2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3209007..3210362
Genome map
AA seq 451 aa AA seqDB search
MGQAYSTIAFDPAKCDGCGKCMTACASVKFDSTDTTRSLIQIVRSGGARIEPPRPGEFEL
ALCRQCADPKCVTVCPAGALGKNGATGVIDWDASKCVDCLLCTIGCTYAGIALDEHSGRV
SKCDTCEGKPACVPACPTGALRHITTARIYNEVGSWEDLFAPGLAGCQGCNTELLMRHAL
RRVGPDTVLATPPGCVPGMGSVGFNGTTGTKVPVFHPLLTNTASMLAGVKRQYERVGRKV
TAMAIAGDGGASDVGFQSLSGAAERGERILFMVVDNEGYMNTGMQRSSCTPYGAWTSTTP
IGAHGRGKTQDAKNLPMIMVNHRCEYVATASTAYMEDLYEKLDKALAASERGFAYLHVYS
PCTTGWRFQSALNIEVARKAVESNFVTLWEYTPEAGLHFTRPVDKPLPVADYLKAMGRFR
HLSPEQVEHIQNKVAENLRFVRKIAEQADEQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggacaagcctactccaccatcgccttcgaccccgccaagtgcgacggctgcggcaaa
tgcatgacggcgtgcgcgagcgtcaagttcgactccaccgacaccacgcgctcgctgatc
cagatcgtgcgcagcggcggcgcccgcatcgagccgccccgcccgggcgagttcgagctc
gcgctgtgccgccagtgcgccgatcccaagtgcgtcaccgtgtgcccggcgggcgcgctc
ggcaagaacggcgccaccggcgtgatcgactgggacgcctcgaagtgcgtcgactgcctg
ctgtgcaccatcggctgcacctacgccggcatcgcgctcgacgagcacagcggccgtgtc
agcaagtgcgacacctgcgagggcaagccggcctgcgtgcccgcctgccccaccggcgcg
ctgcgccacatcaccaccgcgcgcatctacaacgaggtcggcagctgggaagacctgttc
gcacccggcctggcgggctgccagggctgcaacaccgagctgctgatgcgccacgcgctg
cgccgcgtcggccccgacaccgtgctcgccaccccgccgggctgcgtgcccggcatgggc
tcggtgggcttcaacggcaccaccggcaccaaggtcccggtcttccacccgctgctcacc
aacaccgcgtcgatgctcgccggggtcaagcgccagtacgagcgcgtcggccgcaaggtc
accgcgatggcgatcgccggcgacggcggcgcctcggacgtcggcttccagtcgctctcg
ggcgcggccgagcgcggcgagcgcatcctcttcatggtggtcgacaacgagggctacatg
aacaccggcatgcagcgctcgagctgcacgccctacggcgcatggacctcgaccaccccg
atcggcgcacatggccgcggcaagacgcaagacgccaagaacctgccgatgatcatggtg
aaccaccgctgcgaatacgtcgccaccgcgtcgaccgcgtacatggaggacctctacgag
aagctcgacaaggccctcgccgcctccgagcggggcttcgcctacctgcacgtgtattcg
ccctgcaccaccggctggcgcttccagagcgcgctcaacatcgaggtcgcgcgcaaggcg
gtggagtcgaacttcgtcaccctgtgggaatacacccccgaggccgggctgcacttcacc
cgcccggtggacaagccgctgccggtggccgactacctcaaggccatggggcgcttccgc
cacctcagcccggagcaggtcgagcacatccagaacaaggtggccgagaacctgcgcttc
gtgcgcaagatcgcggagcaggccgatgagcaatga

DBGET integrated database retrieval system