KEGG   Thauera sp. MZ1T: Tmz1t_2974Help
Entry
Tmz1t_2974        CDS       T00804                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
tmz  Thauera sp. MZ1T
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tmz00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tmz02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3221421..3221795)
Genome map
AA seq 124 aa AA seqDB search
MSRSVPLRAVVAILGVLAVPAPALAADIGESGFVQCAACHPAAAGQPHGVGPNLHGRFGR
AIAGTPGFVFSRALRKREGVWTEAELDRWLADPQAYAPGTKMAYAGLKDPAQRRAVIEYL
KTLR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatccgtcccgctgcgcgccgtggtcgcgatcctcggcgtgctcgccgtgccg
gcaccggcgcttgccgccgacatcggcgagtccggcttcgtccagtgcgccgcctgccat
cccgccgctgcagggcagccccacggcgtggggcccaacctgcacggtcgcttcggacgg
gcgatcgcgggcaccccgggtttcgtcttttcccgcgcactccggaagcgcgagggggtg
tggacggaggcggagctggaccgctggctcgccgatccgcaggcctacgcgcccgggacc
aagatggcctatgcgggcctgaaggacccggcccagcgccgggcggtgatcgagtacctg
aagacgctgcgctga

DBGET integrated database retrieval system