KEGG   Thauera sp. MZ1T: Tmz1t_3061Help
Entry
Tmz1t_3061        CDS       T00804                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmz1t_3061
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmz1t_3061
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmz1t_3061
Enzymes [BR:tmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmz1t_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3314220..3315041)
Genome map
AA seq 273 aa AA seqDB search
MSRIQTVFQRLQADGRKALIPFVTAGFPAPALTLPLMNALVEGGADILELGVPFSDPMAD
GPTIQRASERALAQGMSLRKVLETVRAFRAANADTPVVLMGYANPIEAMGQERFVAAAHE
AGVDGVLVVDYPPEECVSFAATAKAGGLDPIFLLAPTSGEQRFADVARAGSGYIYYVSLK
GVTGSAKLDVDEVARRIPEIRAAVGMPVGVGFGIRDAESAQRIGAVADAVVIGSRIIEEI
ENNPGDEVARVRDFMRPIRAALDALATGRGVQA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagaatccagaccgttttccagcgcctccaggccgatggccgcaaggcgctgatt
cccttcgtcaccgccggcttcccggcgcccgcgctcaccctgccgctgatgaacgcgctg
gtcgagggcggcgccgacatcctcgagctcggcgtgcccttctccgacccgatggccgac
ggccccaccatccagcgcgcctccgagcgcgcgctcgcgcagggcatgagcctgcgcaag
gtgctcgagaccgtgcgcgccttccgcgccgccaatgccgataccccggtggtgctgatg
ggctacgccaacccgatcgaggccatgggccaggagcgcttcgtcgctgccgcgcatgaa
gccggagtcgatggcgtgctggtggtcgattacccgccagaggagtgcgtgagcttcgcc
gctaccgccaaggccggcggcctcgatcccatcttcctgctcgcgcccacctcgggcgag
cagcgcttcgccgatgtcgcgcgcgccggcagcggctatatctactacgtctcgctcaag
ggcgtgaccggcagcgccaagctcgacgtcgacgaggtcgcccgccgcattcccgagatc
cgcgccgcggtcggcatgccggtgggcgtgggcttcggcatccgcgacgccgagagcgcg
cagcgcatcggcgcggtggccgacgcggtcgtgatcggcagccggatcatcgaggagatc
gagaacaacccgggtgacgaggtggcgcgtgtgcgcgacttcatgcgcccgatccgcgcc
gcgctggacgcgctggcgacgggcaggggggtacaggcatga

DBGET integrated database retrieval system