KEGG   Thauera sp. MZ1T: Tmz1t_3062Help
Entry
Tmz1t_3062        CDS       T00804                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00260  Glycine, serine and threonine metabolism
tmz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01130  Biosynthesis of antibiotics
tmz01230  Biosynthesis of amino acids
Module
tmz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmz1t_3062
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmz1t_3062
Enzymes [BR:tmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmz1t_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACR01660
JGI: Tmz1t_3062
UniProt: C4KB84
Position
complement(3315097..3316308)
Genome map
AA seq 403 aa AA seqDB search
MQMADTPYQFPDASGHFGPYGGIFVAETLMPALAELREAYAACQNDPAFVAEFEYELKHY
VGRPSPIYHAKRWSELLGGAQIYLKREDLNHTGAHKVNNCIGQAMVARRMGKPRVIAETG
AGQHGVATATVAARYGMECVVYMGSEDVKRQAANVYRMKLLGATVVPVESGSKTLKDALN
EAMRDWVTNVADTFYIIGTVAGPHPYPMMVRDFQSVIGKECLVQMPDMVGRQPDYVIACV
GGGSNAMGIFHPYIGVPGVRLVGVEAAGDGLDTGRHSASLTAGRPGVLHGNRTYLLQDED
GQIIETHSVSAGLDYPGVGPEHAWLKDTARAEYVGITDAEALEAFHKLCRLEGIIPALES
SHALAYAAKLAPSLPKDKILLVNLSGRGDKDMHTVAERSGIQF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagatggctgacacgccttaccagtttcccgacgcgagcgggcatttcgggccctac
ggcggcatcttcgtcgccgaaaccctgatgccggcgctcgccgagctgcgcgaggcctac
gcggcctgccagaacgatccggcgttcgtcgccgagttcgagtacgagctcaagcactac
gtcggccgcccgagcccgatctaccatgccaagcgctggtcggagctccttggcggcgcg
cagatctacctcaagcgcgaggatctcaaccacaccggcgcgcacaaggtgaacaactgc
atcggccaggccatggtcgcccgccgcatgggcaagccgcgcgtgatcgccgagaccggt
gccggccagcacggtgtggccaccgccaccgtggccgcacgctacggcatggagtgcgtg
gtctacatgggttcggaagacgtcaagcgccaggccgccaacgtctaccgcatgaagctg
ctcggcgccaccgtggtgccggtcgagtccggctcgaagacgctcaaggatgcgctcaac
gaagccatgcgcgactgggtgaccaacgtcgccgataccttctacatcatcggcaccgtc
gccggcccgcacccgtatccgatgatggtgcgcgacttccagtcggtgattggcaaggaa
tgcctggtgcagatgcccgacatggtgggccgccagcccgactacgtgatcgcctgcgtg
ggcggcggctccaacgcgatgggcatcttccatccctacatcggcgtgccgggcgtcagg
cttgtcggcgtcgaagccgccggcgacggcctggacacggggcgccactcggcctcgctg
accgccggccgccccggtgtgctgcacggcaaccgcacctacctgctgcaggacgaggac
gggcagatcatcgagacgcactcggtctccgccggactcgactacccgggcgtcggtccc
gagcacgcctggctgaaggacaccgcacgcgccgagtatgtcggcatcaccgacgccgag
gcgctcgaggccttccacaagctgtgccggctggagggcatcattccggcgctcgagtcc
tcgcacgcgctcgcctacgccgccaagctggcgccctccctgcccaaggacaagatcctg
ctggtcaacctctccgggcgcggcgacaaggacatgcacaccgtcgccgagcgctccggc
atccagttctga

DBGET integrated database retrieval system