KEGG   Thauera sp. MZ1T: Tmz1t_3211Help
Entry
Tmz1t_3211        CDS       T00804                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tmz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tmz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tmz00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tmz00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tmz00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tmz00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tmz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3513452..3514705)
Genome map
AA seq 417 aa AA seqDB search
MRQQNLLYAHSGGVTAVINASAAAVVAAARASGRVGKVFAAWRGIVGVLEEALIDTAGLD
EAALVRLARTPGGAFGSCRFDLPHDDGGAAMDRLFAVFDAHDIGWLLYNGGNGSMDAVAR
IQAEAARRGHALVCVGVPKTVDNDIVGTDCCPGFGSAARYLATSMLEAGLDTASMVGSKG
SVFVMEVMGRNTGWLAAATALAAQGDPDRAPHIVLVPEARFDEAAFLARVREIVERLGYC
AVTVAEGIRRPDGSLLMEKSRDARGYVQLGGAGLAVARRINERLGYKFHWAIPDYLQRSA
GHWLSATDRAQAEAVGRVAVEYALAGQGGTMPAIRRLQDAPYRWDVVAVDTAAVANLERS
LPDGFVRADGLHVTTAACDYMRPLIEGEIPPPVAGGLPDYGRWDWAPVARRLAAWQA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagcagaaccttctgtatgcccattccggtggcgtaaccgccgtcatcaacgcc
agcgccgcggcggtcgtcgcggccgcgcgcgcctcgggtcgggtcggcaaggtgttcgcc
gcgtggcgcggcatcgtcggcgtgctcgaggaggccctgatcgataccgccggcctggac
gaggcggcgctcgtccgcctggcgcgcaccccgggcggggccttcggctcctgccgcttc
gatctgccgcacgacgacggcggcgcggcgatggatcggctgttcgcggttttcgacgcg
cacgacatcggctggctgctctacaacggcggcaacggctcgatggacgcggtcgcgcgc
atccaggccgaggccgcgcggcgcggccatgcgctggtgtgcgtgggcgtgcccaagacg
gtggacaacgacatcgtcggtaccgactgctgtcccggcttcggctcggccgcgcgctac
ctcgccacttcgatgctggaggcggggctggacaccgcgtcgatggtgggcagcaagggc
agcgtcttcgtcatggaggtgatggggcgcaacaccggctggctggccgcggccaccgcg
ctcgccgcgcagggcgacccggaccgcgccccgcatatcgtgctggtaccggaggcgcgc
ttcgacgaagcggccttcctcgcccgcgtgcgcgagatcgtcgaacggctgggctattgt
gcggtgacggtggcggagggcatccgccgaccggatggcagcctgctgatggagaagtcg
cgcgatgcgcgcggctacgtccagctcggcggcgcgggtctggcagtggcgcggcggatc
aacgagcgcctcggctacaagttccactgggcgatccccgactacctgcagcgctcggcc
ggacactggctgtcggcgaccgaccgcgcgcaggccgaagcggtcggaagggtggcggtg
gagtacgcgctcgccggccagggcgggaccatgcccgcgatccgccgcctgcaggatgcg
ccctaccgctgggatgtggtcgcggtggacaccgccgcggtggccaacctcgagcgcagc
ctgccggacggtttcgtgcgcgccgacgggctgcacgtgaccacggcggcctgcgactac
atgcgtccgctgatcgagggcgagattccgccgccggtggcgggcggcctgcccgactac
gggcgctgggactgggccccggtggcgcgccggctggcggcgtggcaggcctga

DBGET integrated database retrieval system