KEGG   Thauera sp. MZ1T: Tmz1t_3247Help
Entry
Tmz1t_3247        CDS       T00804                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tmz  Thauera sp. MZ1T
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tmz1t_3247
Enzymes [BR:tmz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Tmz1t_3247
Peptidases [BR:tmz01002]
 Cysteine Peptidases
  Family C44
   Tmz1t_3247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3551718..3553574
Genome map
AA seq 618 aa AA seqDB search
MCGINGIFAYAPAANAVDRAELLRVRDTMIERGPDGAGVWTGDDGRIGLGHRRLAILDLS
AAGAQPMHSADGTLVVSFNGEIYNYPELRGDLERAGVEFRSHSDTEVLLHLYRRHGPAMV
GRLRGMFAFALWDARARSLLLARDPHGIKPLYYADDGRTLRFASQVSALLAGEGVDTRPE
PAGAVGFLLWGSVPEPFTLYRGIRLLPAGSTLLVNEAAGAGAAVRYWSLSAALQRSVQAA
AAVPAGGEAAFMRERLLESVRAHLLSDVPVGAFLSAGLDSSTLVGLAREASPARLRTLTL
TFDDLQGTAHDECPAASLIARHLDVDHTCIVLSAGEQEDELDRFFAAMDQPTIDGINTWF
VSRAAQQAGLKVALSGLGGDELLGGYVTFAEHPRLRARAHASPWRHAPRLYRGAHRLLGA
RLGWPPNAAGIPACGADPEGAYHLLKGVFMPWELDGVVDADVLCEGLQALAEHDAAHTEA
LAGLNDFGQVACLESVRYMRNQLLRDTDWVSMSHSLEIRVPLVDHLLSEALLGLAASGRL
GPGKSMLPRTLARGLPDEILNRPKSGFVVPTWRWLRHHPGLDAWKSLPALRHPRMSDGRR
WAYTLLSRHPAGKALIRN
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggcatcaacgggatcttcgcctacgcccccgctgctaacgcagtggaccgcgcc
gaactgctgcgggtgcgcgacaccatgatcgagcgcggccccgacggtgccggcgtgtgg
accggcgacgacgggcggatcggcctcggccaccggcgcctcgccatcctcgatctcagc
gcggcgggcgcccagccgatgcactcggcggacggcacgctggtggtcagcttcaacggc
gagatctacaactaccccgagctgcgcggcgatctcgagcgcgccggcgtcgagttccgc
tcccattccgacaccgaggtgctgctgcacctgtatcgccgtcacggtcccgcgatggtg
ggccgcctgcgcggcatgttcgccttcgcgctgtgggacgcgcgggcgcgcagcctgctg
ctcgcgcgcgacccccacggcatcaagccgctgtattacgcggacgacggcaggaccctg
cgcttcgcctcccaggtctccgccctgctggccggcgaaggcgtcgacacgcgccccgaa
cccgcgggagcggtcggattcctgctgtggggctcggttccggaaccgttcacgctctac
cgcggcatccgcctgctgccggcaggctcgaccctgctggtgaacgaagcggccggcgcc
ggcgcggcggtacgctactggagcctgtccgccgccctgcagcgctcggtgcaggccgcg
gcggccgtcccggccggcggggaggccgccttcatgcgcgaacgcctgctcgagagcgtg
cgcgcccacctgctctccgacgttccggtcggtgcgttcctgtccgcagggctggattcg
tccaccctggtcggcctcgcccgcgaagcctcgcccgcccgcctgcgcacgctcaccctg
acgttcgacgacctgcagggcacggcgcacgacgaatgtccggccgcgagcctgatcgcc
cgccatctggacgtcgaccacacctgcatcgtgctctctgcgggcgaacaggaagacgag
ctcgatcgcttcttcgccgcgatggaccaaccgaccatcgacggcatcaacacctggttc
gtgagccgcgcagcacaacaggccggcctcaaggtcgcactctcgggcctgggaggggac
gaattgctcggcggctacgtcaccttcgcagagcatccgcggctgcgcgcgcgcgcccac
gccagcccctggcggcacgcaccccggctctaccgcggcgcccaccgcctgctcggtgcc
cgcctcggctggccgcccaacgcggccgggatcccggcttgcggcgccgatccggagggc
gcgtaccatctgctcaagggcgtgttcatgccctgggaactggacggcgtggtcgatgcc
gacgtcctctgcgaaggcctgcaagccctcgccgaacacgatgcggctcacaccgaggcg
cttgcggggctgaacgacttcggccaggtcgcctgcctggagtcggtgcgctacatgcgc
aaccagctgctgcgcgacaccgactgggtcagcatgtcgcactcgctggagatccgggtg
ccgctggtggaccacctgctcagcgaggccctgctcggtctcgccgcgagcggacgcctc
ggcccgggcaagagcatgctgccgcggacgctggcacgcggcctgcccgacgagatcctg
aaccgccccaagagtggtttcgtcgttcccacctggcgctggctgcgccaccatccgggg
ctcgatgcgtggaagtccttgcccgcgctgcgccacccgcgcatgtccgatggccggcgc
tgggcctacacgctgctgagccgccacccggcaggcaaggccctgatccgcaactga

DBGET integrated database retrieval system