KEGG   Thauera sp. MZ1T: Tmz1t_3293Help
Entry
Tmz1t_3293        CDS       T00804                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00051  Fructose and mannose metabolism
tmz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tmz1t_3293
Enzymes [BR:tmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Tmz1t_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II DUF3145 Colicin_Ia PIF1 DUF2944
Motif
Other DBs
NCBI-ProteinID: ACR01888
JGI: Tmz1t_3293
UniProt: C4KC07
Position
3609529..3610218
Genome map
AA seq 229 aa AA seqDB search
MSAGTPGCIHEEAGWRGADDARASLLHTLRAMGAARLNVGTSGNASQRLEGGRMLISPSG
IPAERCRTEDMVVVEADGRYAGARAPSSEWPLHHDVYTAFPAAGAVLHAHAPFATALACQ
RLDIPPFHYMIARFGGTTVRCARYATFGTQALSDATVAALQERSACLLANHGMVVLGRDL
EHALAMAIEFETLCEQYWRTLQLGEPVLLSEEEMAEVIERFKWYGKPRA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccggcacgcccggctgcatccacgaggaagccggctggcgcggcgcggacgac
gcgcgcgccagcctgctccacaccctgcgcgcgatgggcgcggcgcggctcaacgtcggc
acctcgggcaacgccagccagcgcctcgagggcgggcgcatgctgatcagcccgagcggg
atccccgccgagcgctgccgcaccgaggacatggtggtcgtggaggccgacggccgctac
gccggcgcgcgcgcgccctcgtccgaatggccgctgcaccacgacgtctataccgccttc
ccggcggccggcgcggtgctgcacgcgcatgcgcccttcgcgaccgcactcgcctgccag
cgcctcgacatccctcccttccactacatgatcgcgcgcttcggcggcaccacggtgcgc
tgtgcgcgctacgccactttcggcacccaggcgctgtccgacgccaccgtggcggcgctg
caagagcgcagcgcctgcctgctcgccaaccacggcatggtcgtcctcggccgcgacctc
gagcacgcgctggcgatggcgatcgagttcgagaccctctgcgagcagtactggcgcacc
ctgcagctgggcgagccggtgctgctgtcggaagaggagatggccgaggtgatcgagcgc
ttcaagtggtacggcaagccacgcgcgtga

DBGET integrated database retrieval system