KEGG   Thauera sp. MZ1T: Tmz1t_3293Help
Entry
Tmz1t_3293        CDS       T00804                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tmz  Thauera sp. MZ1T
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tmz1t_3293
Enzymes [BR:tmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Tmz1t_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3609529..3610218
Genome map
AA seq 229 aa AA seqDB search
MSAGTPGCIHEEAGWRGADDARASLLHTLRAMGAARLNVGTSGNASQRLEGGRMLISPSG
IPAERCRTEDMVVVEADGRYAGARAPSSEWPLHHDVYTAFPAAGAVLHAHAPFATALACQ
RLDIPPFHYMIARFGGTTVRCARYATFGTQALSDATVAALQERSACLLANHGMVVLGRDL
EHALAMAIEFETLCEQYWRTLQLGEPVLLSEEEMAEVIERFKWYGKPRA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccggcacgcccggctgcatccacgaggaagccggctggcgcggcgcggacgac
gcgcgcgccagcctgctccacaccctgcgcgcgatgggcgcggcgcggctcaacgtcggc
acctcgggcaacgccagccagcgcctcgagggcgggcgcatgctgatcagcccgagcggg
atccccgccgagcgctgccgcaccgaggacatggtggtcgtggaggccgacggccgctac
gccggcgcgcgcgcgccctcgtccgaatggccgctgcaccacgacgtctataccgccttc
ccggcggccggcgcggtgctgcacgcgcatgcgcccttcgcgaccgcactcgcctgccag
cgcctcgacatccctcccttccactacatgatcgcgcgcttcggcggcaccacggtgcgc
tgtgcgcgctacgccactttcggcacccaggcgctgtccgacgccaccgtggcggcgctg
caagagcgcagcgcctgcctgctcgccaaccacggcatggtcgtcctcggccgcgacctc
gagcacgcgctggcgatggcgatcgagttcgagaccctctgcgagcagtactggcgcacc
ctgcagctgggcgagccggtgctgctgtcggaagaggagatggccgaggtgatcgagcgc
ttcaagtggtacggcaagccacgcgcgtga

DBGET integrated database retrieval system