KEGG   Thauera sp. MZ1T: Tmz1t_3432Help
Entry
Tmz1t_3432        CDS       T00804                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tmz  Thauera sp. MZ1T
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tmz1t_3432
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tmz1t_3432
Enzymes [BR:tmz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Tmz1t_3432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3756390..3757886)
Genome map
AA seq 498 aa AA seqDB search
MQALAVLDRLRALGVHADDITADSRKAGPGCVFAAWPGQRTDGRRFLADAVVHGAAALLW
EDGDGFCAPALAVPGFGVRGLRELAGHLAHELHGRPSQSLWLAGVTGTNGKTTVSQMLAR
ALGELGERCGIVGTLGCGFPDALEEGLNTTPDALELQRWFARFRNQGAVAAAMEVSSIGL
DQGRVNGAQFDVAIFTNLSRDHLDYHGTMEAYAAAKARLFERPELSACVINIDDPWGLAL
ARRLVVEGRAVIACTLYAANADAVPGARVLRADRLQAAPAGLRFTLVWEGREAEIGVRMV
AHFNVSNLIAVAGALLARGIAFDELPPVLGRLAPPQGRMQLVGGVCEPLVVIDYAHSPDA
LAKVLEALRGTVHSRRGRLVCVFGCGGDRDPGKRPMMGEIASAIADRVVITSDNPRSEDP
QRIVEAIAAGAGAAAECVVDRAQAITRAVGEARADDVVLIAGKGHEPYQEILGQRLPFSD
LEQAKRALAAWHARENGR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccctcgcggtgctcgatcgactgcgtgcgctcggcgtccacgccgacgacatc
accgccgattcgcgcaaggccggcccgggttgcgtgttcgcggcctggcccggccagcgc
accgatggccgccgcttcctcgccgatgcagtcgtgcatggcgccgccgcgctgttgtgg
gaggatggcgacggattctgcgcgcccgcgctcgcggtgcccggtttcggcgtgcgtggc
ctgcgcgagctcgccgggcaccttgcccacgaactccacggccggccttcgcagtcgctt
tggctagccggcgtcaccggcaccaacggcaagaccaccgtctcgcagatgctcgcgcgt
gcgctcggcgaactcggcgagcgctgcggcatcgtcggtacgctcggctgcgggttcccc
gacgccctcgaggaagggctcaacaccacgcccgacgcgctcgaattgcagcgctggttt
gcgcgcttccgcaaccagggggcggtggccgcggcgatggaggtgtcttcgatcgggctc
gaccaggggcgggtcaatggtgcgcagttcgacgtcgcgatcttcaccaacctgagtcgc
gaccacctcgattaccacggcaccatggaagcctacgccgcggccaaggcgcgcctgttc
gagcgcccggagctgtcggcctgcgtgatcaacatcgacgatccctggggcctggcgctg
gcgcgccggctcgtcgtcgaggggcgcgcggtgatcgcatgcaccctctacgccgccaac
gccgacgcggtgcccggcgcgcgcgtgctgcgcgccgatcgcctgcaggcggcgcccgca
ggactgcgcttcaccctcgtctgggaggggcgcgaggccgagatcggcgtgcgcatggtg
gcgcacttcaacgtctccaacctgatcgcggttgcgggcgcgctgctggcgcgcggcatc
gccttcgacgagctgccgccggtgctcggtcggctggcgccgccgcaggggcgcatgcag
ctcgtcggcggggtgtgcgagccgctcgtggtgatcgactacgcgcattcgcccgatgcc
ctcgccaaggtgctcgaagccttgcgcggcacggtgcatagccgccgcggccgcctggtg
tgcgtgttcggctgcggcggcgaccgcgacccgggcaagcgcccgatgatgggcgagatc
gccagcgcgatcgccgatcgcgtagtgatcaccagcgacaacccgcgttcggaggatccg
cagcgcatcgtcgaggccattgccgccggcgccggcgccgcggccgaatgcgtggtcgac
cgcgcgcaggcgatcacccgcgcggtgggcgaggcgcgggccgacgacgtcgtgctgatc
gcaggcaagggccacgagccgtaccaggaaatcctcggccagcgcctgcctttttcggac
ctggagcaggcgaagcgcgcgctcgccgcctggcatgcaagggagaatggccgatga

DBGET integrated database retrieval system