KEGG   Thauera sp. MZ1T: Tmz1t_3459Help
Entry
Tmz1t_3459        CDS       T00804                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tmz  Thauera sp. MZ1T
Brite
Enzymes [BR:tmz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tmz1t_3459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3781692..3782345)
Genome map
AA seq 217 aa AA seqDB search
MNFEKARFNMVEQQIRPWEVLDQDVLDLLMTVKREEFVPAAHRELAFADVEIPIGCGQVM
LKPVIEGKILQALRVTKSDTVLEIGAGSGWFAALLAARAEWVRTMEIEPELVKLASANLE
RNGVHNVVVVDGDGVQGWSGRAPYDVIVVSGGLPFVPQSLLEQLKVGGRLFAFVGEAPVM
KARLITCEGEGRFRTEDVFETVVPMLKNAPQREAFSF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgagaaagcgcgcttcaacatggtcgagcagcagatccgcccctgggaggtg
ctggatcaggacgtgctcgacctcctgatgacggtcaagcgcgaggaattcgttcccgcc
gcgcatcgcgagctggccttcgccgacgtcgagatcccgatcggctgtggccaggtcatg
ctcaagccggtgatcgaaggcaagatcctgcaggcgctgcgtgtcaccaagtccgacacc
gtgctcgagatcggcgccggctcgggctggttcgccgcgctgctggcggcgcgtgccgag
tgggtgcgcaccatggagatcgagcccgagctggtgaagctggcgagcgccaacctcgag
cgcaacggcgtgcacaacgtggtcgtggtcgacggcgacggtgtgcagggatggtctggc
cgcgcgccctacgacgtgatcgtcgtttccggcgggctgcccttcgtgccgcagtcgctg
ctcgagcagctcaaggtgggtggtcgcctgttcgccttcgtcggcgaggcgccggtcatg
aaggcgcgcctgatcacctgtgagggcgaaggccgcttccgtaccgaggacgtgttcgag
accgtggtgcccatgctcaagaacgcgccccagcgcgaagccttcagcttctga

DBGET integrated database retrieval system