KEGG   Thauera sp. MZ1T: Tmz1t_3511Help
Entry
Tmz1t_3511        CDS       T00804                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tmz  Thauera sp. MZ1T
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tmz00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tmz00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3848043..3849425
Genome map
AA seq 460 aa AA seqDB search
MGGAGLVSRGLNRVRELVASAAHLGKPPDESDLERLRTQLQECAEGRGGEVSTRQRAARL
AETYLRLDDVGRHAFLRLIAHEFGPDPARVAQAHAAYQAAVGTPRQWDAEAELRAALRSR
RLRILTQFNAIPQGVKFLVDLRADLLRLIADDPLLKPLDRELETRLSAWFDVGFLELQRI
TWSSPAALLEKLVEYEAVHEIRSWKDLKNRLDSDRRCYAFFHPRMPLEPLIFVQVALLEE
IADDVQRLLDIEAPLADASRATTAIFYSISATQKGLRGVSFGNFLLKRVIDDLKRDFPRL
KTFATLSPMPGLVRWAQRDPEAFAEAFTATDWKRLATLGIEGVDSTGLAAVLAGDPAWVE
DEALAESLREPLLRLGARYLSEARRGDRPVDTVARFHLGNGARIERLNWLADRSDKGLRQ
SWGLMVNYLYDPDRLEANLESFAANGSIAASSAVRRLARR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgcaggactggtctcccgggggctgaaccgcgttcgcgagctcgtcgcgagc
gccgcgcatttgggcaagcccccggatgagagcgacctcgagcgcctgcgcacgcagttg
caggagtgcgccgagggccgcggcggcgaagtatcgacgcgccagcgtgccgcccgcctg
gccgagacctatctgcgcctggacgacgtcggccgccacgccttcctgcgcctgatcgcc
cacgagttcggccccgatccggcgcgggtggcgcaggcgcacgccgcctaccaggccgcg
gtcggcacgccgcggcaatgggacgcggaagccgagctgcgcgccgcgctgcgctcgcgc
cggctgcgcatcctcacccagttcaacgcgatcccgcagggggtcaagttcctcgtcgac
ctgcgtgccgacctgctgcgcctcatcgccgacgatccgctgctcaagccgctcgaccgc
gagctcgagacgcgcctgtcggcgtggttcgacgtcggcttcctggaactgcagcgcatc
acctggagttcgcccgccgccctgctcgagaagctcgtcgagtacgaggcggtgcacgag
atccgctcctggaaggacctcaagaaccggctcgactccgaccgccgctgctacgccttc
ttccatccgcgcatgccgctcgagccgctgatcttcgttcaggtcgcactgctcgaggag
atcgccgacgacgtgcagcgcctgctcgacatcgaggcgccgctcgccgatgcgagccgg
gcgacgaccgcgatcttctattcgatcagcgccacgcaaaagggcctgcgcggggtgagc
ttcggcaacttcctgctcaagcgggtgatcgacgacctcaagcgcgactttccgcgcctg
aagaccttcgccacgctgtcgccgatgccgggcctggtgcgctgggcgcagcgcgacccg
gaggccttcgccgaggccttcaccgccaccgactggaagcgcctggcgacgctcggcatc
gaaggcgtcgactcgacgggcctcgccgcggtgctcgccggcgacccggcgtgggtcgag
gacgaggcgctcgccgagtccttgcgcgagcccctgctgcggctgggcgcacgctacctg
agcgaggcacgccgcggcgaccgcccggtcgacacggtggcgcgcttccacctcggcaac
ggtgcccgcatcgagcgcctgaactggctcgccgaccgctcggacaagggcctgcgccag
tcttggggattgatggtcaattatctgtacgacccggaccgcctggaagccaacctggag
agcttcgctgccaacggcagcatcgcagcctcgtccgcggtgcgcaggctcgcccggcgc
tga

DBGET integrated database retrieval system