KEGG   Thauera sp. MZ1T: Tmz1t_3522Help
Entry
Tmz1t_3522        CDS       T00804                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tmz  Thauera sp. MZ1T
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3857387..3858388)
Genome map
AA seq 333 aa AA seqDB search
MMKLKATSVAVALVVAGSAWAAVAVRDEPIKPIEPAKVENAAKVELGKKLWFEPRLSMSG
IISCNTCHNLSMGGTDNLKTSIGHGWKAGPVNSPTVYNSSLAIAQFWDGRAADLKEQAGG
PIQAGVEMNMPHTLAVGILQSIPGYVEEFESVYGKNKIDIDMITDSIAEFEKTLVTPDSR
FDKWLRGDDKALSEKELAGYTLFKESGCVACHNGPAAGGTSFQRMGVVEPYKSSSPAEGR
SAVTGADADRFNFKVPTLRNVALTYPYFHDGEAATLEQAVDTMGRLQLGRTYSKDEIGQI
VAFLKTLTGELPQIAMPVLPPSSNATPRPDPFK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagttgaaggcaacgagcgtggcggtggcattggtggtggctggcagcgcctgg
gcggccgtggcggtgcgggacgaaccgatcaagccgatcgagccggcgaaggtggagaac
gccgccaaggtcgagctcggcaagaagttgtggttcgagccgcgcctgtcgatgtcgggc
atcatctcctgcaatacctgccacaacctgtcgatggggggcaccgacaacctcaagacc
tcgatcggccacggctggaaagccggtccggtgaactcgccgaccgtctataactccagc
ctggcgatcgcccagttctgggacggccgtgcggccgacctcaaggagcaggccggcggc
ccgatccaggccggcgtcgagatgaacatgccgcacaccctggcggtcggcatcctgcag
tcgatcccgggctacgtcgaagagttcgagtcggtgtacggcaagaacaagatcgacatc
gacatgatcaccgactcgatcgccgagttcgagaagaccctggtcacgcccgattcgcgc
ttcgacaagtggctcaggggcgacgacaaggcgctgtccgagaaagagctcgccggctac
accctattcaaggaaagcggctgcgtggcctgccacaacggtccggcggccggcggcacg
tcattccagcgcatgggcgtggtcgagccgtacaagagcagctcgcccgccgaaggccgc
tcggcggtcaccggtgccgatgccgaccgcttcaacttcaaggtgccgaccctgcgcaac
gtcgcgctgacctacccgtacttccacgacggcgaggcggcgacgctcgagcaggcggtg
gataccatggggcgcctgcagctcggccgcacctacagcaaggatgagatcggacagatc
gtcgccttcctgaagacgctgaccggcgaactgccgcagatcgcgatgccggtgctgccg
ccgtcgagcaacgcgacgccgcgtcccgatccgttcaagtaa

DBGET integrated database retrieval system