KEGG   Thauera sp. MZ1T: Tmz1t_3541Help
Entry
Tmz1t_3541        CDS       T00804                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tmz  Thauera sp. MZ1T
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tmz1t_3541
Enzymes [BR:tmz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Tmz1t_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3881664..3883244)
Genome map
AA seq 526 aa AA seqDB search
MEPQAGPLPATAESASPLRLRRVAIDTWRENVAYLHRDCAIYRAEGFQALSKVEVRANGR
RILATLNVVDDGCIVEPEELGVSIDAFFQLGVDDGHPAMIAQAEPPSSIPALHRKIAGER
LAREDFRAIVRDIAEHRYSKIELTAFVVATNQGELDREEVSFLTEAMAAVGDRIDWHERP
VVDKHCIGGIPGNRTSMLVVPIVAAHGMLCPKTSSRAITSPAGTADTMEVLARVELPTEE
LSGIVREHRGCLAWGGTANLSPADDVLISVERPLSIDSPGQMVASILSKKLAAGSTHLVL
DIPVGPTAKVRSMAEAQKLRKLFEFVAGRMNLTIDVVITDGRQPIGSGIGPVLEARDVMR
VLENDPRAPYDLRQKALRLAGRMLEFDPDVRGGDGFAIARDILDSGRALAKMDAIIRAQG
ARAFDHNAPQLARLSFEVCAEADGVVVAIDNHQLARIARLAGAPKMQGSGVDLLRKLGEP
VGRGEPLYRVHADYPADLEFARQASVRASGYALGTADGVPHLFVEF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggaaccacaagccggaccgcttcccgccaccgccgagtcggcctctcccctgcgcctg
cgcagggtggcgatcgatacctggcgcgagaacgtcgcctacctgcaccgcgactgcgcg
atctatcgcgccgagggtttccaggccctttccaaggtcgaggtgcgggccaacgggcgc
cgcatcctcgccaccctcaacgtcgtcgacgacggctgcatcgtcgagcccgaagagctc
ggggtgtcgatcgacgccttcttccagctcggcgtcgacgacggccatccggcgatgatc
gcgcaggccgagccgccgtcctccatcccggcgctgcatcgcaagatcgccggcgagcgg
ctcgcccgtgaggacttccgcgccatcgtccgcgacatcgccgagcaccgctattccaag
atcgagctcaccgccttcgtggtcgccaccaaccagggcgaactcgatcgcgaggaggtc
tctttcctcaccgaggcgatggcggcggtgggcgaccgcatcgactggcacgagcgcccg
gtggtggacaagcattgcatcggcggcatccccggcaaccgcacctcgatgctggtggtg
ccgatcgtcgccgcgcacggcatgctgtgccccaagacctcctcgcgcgcgatcacttcg
cccgcggggaccgccgacaccatggaggtgctcgcgcgcgtcgaactgccgaccgaggag
ctgtcgggcatcgtgcgcgagcatcgcggctgcctcgcctggggcggcaccgccaacctg
tcgccggccgacgacgtgctgatctcggtcgagcgtccgctgtcgatcgactcgcccggg
cagatggtggcctccatcctgtccaagaagctcgccgcgggttcgacccacctggtgctc
gacatcccggtgggaccgacggccaaggtgcgctcgatggccgaggcgcagaagctgcgc
aagctcttcgagttcgtcgccgggcgcatgaacctgaccatcgacgtggtcatcaccgat
ggccgccagccgatcggcagcgggatcgggccggtgctggaggcgcgcgatgtaatgcgc
gtgctcgagaacgacccgcgcgcgccctacgacctgcgccagaaggccttgcgtctggcc
gggcgcatgctcgagttcgaccccgacgtgcgcggcggcgacggcttcgcgatcgcgcgc
gacatcctcgactcgggtcgcgcgctggcgaagatggacgcgatcatccgcgcccagggc
gcgcgcgccttcgaccacaacgcgccgcagctcgcccgcctgagcttcgaggtgtgcgcc
gaggccgacggtgtggtggtggcgatcgacaaccaccagctcgcgcgcatcgcccgcctg
gcgggggcgcccaagatgcagggctcgggcgtcgatctgctcaggaagctcggcgagccg
gtgggcaggggcgagcctctctaccgcgtccacgccgactatccggccgatctcgagttc
gcccgccaggccagcgtgcgcgccagcggctacgcgctggggacggcggatggtgtgccg
catctgttcgtggagttctga

DBGET integrated database retrieval system