KEGG   Thauera sp. MZ1T: Tmz1t_3626Help
Entry
Tmz1t_3626        CDS       T00804                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00900  Terpenoid backbone biosynthesis
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tmz1t_3626
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tmz1t_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACR02219
JGI: Tmz1t_3626
UniProt: C4KBP4
Position
3983466..3984353
Genome map
AA seq 295 aa AA seqDB search
MDRPALNTLHTPDCSDPARLAACPAPAKLNLFLHVVGRRADGYHLLQTAFRLLDWGDTID
FAVRTDGAIHRRNEVPGVPEAADLVVRAARLLQAHTGCALGADITVHKVLPMGGGIGGGS
SDAATTLIALNRLWGTGLSRAQLQALGLQLGADVPVFVYGRDAFAEGVGEALQALELAPA
WYVVISPGVQVPTAEIFSARDLTRNTPPIRMADFAASTTRNDLQPVACSRYPEVLRVIEW
LDVHAPARMTGSGACVFAEVSSEEEADRITKDCPPRWKAWKARSIARHPLYEWLQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccctgccctgaacaccctgcacacccccgactgcagcgatcccgcgcgactg
gccgcctgccccgcgccggccaagctcaacctcttcctccacgtcgtcggccgccgcgcc
gacggctaccacctgctgcagaccgcattccgcctgctcgactggggcgacacgatcgac
ttcgccgtacgcacggacggcgcgatccaccgccgcaacgaggtgcccggcgtacccgag
gccgcggacctggtggtgcgcgccgcccgcctgctgcaggcgcacaccggctgcgcgctc
ggcgccgacatcacggtgcacaaggtgctgccgatgggcggcgggatcgggggcggcagt
tcggacgcggcgaccacgctgatcgcgctcaaccgcctttggggcaccgggctgtcacgc
gcgcaactccaggcgctcgggctgcagctcggcgccgacgtgccggtgttcgtctacggc
cgcgacgccttcgccgaaggcgtgggcgaggcgctgcaggcgctcgaactggcgccggcc
tggtacgtggtgatctcgcccggggtccaggtgccgaccgccgaaattttttcggcgagg
gacttgacgagaaatacgccccccatcagaatggcggacttcgcagcaagcactacgcga
aacgacctgcagccggttgcgtgcagtcgctaccccgaagtcttgcgtgtgatcgagtgg
ctggatgtgcatgcaccagcccgcatgacaggctcgggcgcctgcgtgttcgcggaagtc
tcctcggaagaagaggccgaccgcatcacaaaagattgtccgccacgctggaaggcttgg
aaagcgcgcagcatcgctcgccatccgctttacgagtggttacaatag

DBGET integrated database retrieval system