KEGG   Thauera sp. MZ1T: Tmz1t_3654Help
Entry
Tmz1t_3654        CDS       T00804                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmz1t_3654
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmz1t_3654
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmz1t_3654
Enzymes [BR:tmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmz1t_3654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4011269..4012633
Genome map
AA seq 454 aa AA seqDB search
MEATRILLDAADIPTHWYNVAADLPTPLAPPLGPDGHPATPEQMGVIFPPAILEQEMSTE
RWIAIPQEVREIYRLWRPSPLCRAVRLEQALGTPAKIFFKYEGVSPAGSHKPNSAVPQAF
YNKQAGITRLTTETGAGQWGSSIAFAGQMFGLEVRIYMVKVSYDQKPYRRLMMQTWGGEV
FASPSPHTETGRRLLAENPDNPGSLGIAISEAVEEAAGRADTNYTLGSVLNHVVLHQSII
GLEAKKQLDKVGLYPDVVIGPCGGGSSFAGIAFPFLADKAAGDKRAATLRCVAVEPTSCP
TLTKGQYAYDFGDASGFTPLMKMYTLGHDFMPPGIHAGGLRYHGDSPLVSNLLHAGLIEA
AAVPQLATFEAGVQFARAEGIIPAPESCHAIRQAIDEALACKATGEAKTILFNLTGHGHF
DMSSYERYFSGKLEDFDYPAEAVATSLAHLPKVG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaagccacccgcatcctgctcgacgccgccgacatcccgacgcactggtacaacgtc
gccgccgatctgccgacgccgctcgcgccgccgctcggccccgacggccatccggccacg
ccggagcagatgggggtcatcttcccgccggcgatcctcgaacaggagatgagcaccgag
cgctggatcgccatcccgcaggaggtgcgcgagatctaccgcctgtggcggccgagcccg
ctgtgtcgcgcggtgcgcctggagcaggcgctcggcaccccggcgaagatcttcttcaag
tacgagggcgtctcgcccgccggctcgcacaagcccaactccgcggtgccgcaggccttc
tacaacaagcaggccggcatcacccgcctgaccaccgagaccggcgccgggcagtggggc
tcgtcgatcgccttcgccgggcagatgttcgggctggaggtgcgcatctacatggtcaag
gtcagctacgaccagaagccctaccgccgcctgatgatgcagacctggggcggcgaggtc
ttcgccagcccctcgccgcacaccgagaccggccgccgcctgctcgccgagaacccggac
aaccccggctcgctcggcatcgccatctccgaggcggtggaagaggccgccggccgcgcc
gacaccaactacaccctgggttcggtgctcaaccacgtggtgctgcaccagagcatcatc
ggcctggaggcgaagaagcagctcgacaaggtcggcctctatcccgacgtcgtcatcggc
ccctgcggcggcggctcgagcttcgccggcatcgccttccccttcctcgccgacaaggcc
gcgggcgacaagcgcgccgccacgctgcgctgcgtggcggtggagccgacctcctgcccg
accctgaccaagggccagtacgcctacgacttcggcgacgcctccggcttcaccccgctg
atgaagatgtatacgctgggccacgatttcatgccgcccggaatccatgccggcggcctg
cgctaccatggcgactcgccgctggtgtcgaacctgctgcacgccggcctcatcgaggcc
gccgcggtgccgcagctggcgaccttcgaggcgggggtgcagttcgcacgcgccgagggc
atcatcccggcgcccgagtcctgccacgccatccgtcaggccatcgacgaggcgctcgcc
tgcaaggcgaccggcgaggcgaagaccattctgttcaacctgaccggccacggccacttc
gacatgagctcgtacgagcgctacttctcgggcaagctcgaggacttcgactacccggcc
gaggcggtggcaacttcgctcgcccacctgcccaaggtcggctga

DBGET integrated database retrieval system