KEGG   Thauera sp. MZ1T: Tmz1t_3663Help
Entry
Tmz1t_3663        CDS       T00804                                 

Definition
protein disulfide-isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tmz  Thauera sp. MZ1T
Brite
Enzymes [BR:tmz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tmz1t_3663
Secretion system [BR:tmz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Tmz1t_3663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4018633..4019361)
Genome map
AA seq 242 aa AA seqDB search
MKALSVPSLIRPLGLALALGATTFAHADEAGVKKSMEAFIGSPAVERVTRTDYAGLYEVV
LKNGQLVYTDAKNSFIIDGSIIDTATRRDVTQARLNQLSAIDFSTLPLDHAVKVVKGKGT
RVIATFEDPNCGYCKRLGKELEQMDDVTVYTFLYPILSEDSRVKSDNIWCAKDKGRAWTD
WVVDGKEPAKASCDTATITRNVELGQSLRISGTPTIFLADGSRIGGYLPRAELEKAMDAA
KR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctttccgtcccgtccctgatccggcccctcggcctcgccctggcgctcggt
gcgaccacgttcgcacacgccgacgaagccggggtcaagaagagcatggaggccttcatc
ggctcgccggcggtggagagggtgactcgtaccgactatgccgggctgtacgaggtcgtg
ctcaagaacggccagctcgtgtataccgatgcgaagaacagcttcatcatcgacggcagc
atcatcgataccgccacgcgccgcgacgtgacccaggcgcgcctcaatcagctctccgcg
atcgacttctccaccctgccgctcgaccacgcggtgaaggtcgtgaaaggcaagggcacg
cgcgtgatcgccaccttcgaggatcccaactgcggctactgcaagcgcctgggcaaggag
ctcgagcagatggacgacgtcaccgtgtacaccttcctgtatccgatcctgagcgaggac
tcgcgtgtcaagtcggacaacatctggtgcgcgaaggacaaggggagggcgtggaccgac
tgggtggtcgatggcaaggagcccgccaaggcgagctgcgataccgcgaccatcacgcgt
aacgtcgaactcggccagagcctccgcatcagcggcacgccgacgatcttcctcgccgac
ggctcgcgcatcggcggctacctgccgcgcgccgaactcgaaaaggcgatggacgccgcc
aagcgctga

DBGET integrated database retrieval system