KEGG   Thauera sp. MZ1T: Tmz1t_3698Help
Entry
Tmz1t_3698        CDS       T00804                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tmz  Thauera sp. MZ1T
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tmz00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tmz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4064253..4065212
Genome map
AA seq 319 aa AA seqDB search
MRNPQLNQHGELQHLLTLDGLPRNILNAILDTAAPFTEVAEREVKKLPLLRGKSVFNLFF
ENSTRTRTTFEIAAKRLSADVVNLNINTSSAAKGESLLDTVDNLCAMQADMFVVRHAASG
APMLIAQHLQNTGRDHIHVVNAGDGRHAHPTQGLLDMYTIRHFKKDFTNLTVAIVGDVLH
SRVARSQIAALTTLGVPEVRVIGPRTLLPTEVEKLGVRVFHDMREGLKGVDVVMMLRLQN
ERMNGALLPTPQEYYKIWGLTAEKLALARPDAIVMHPGPMNRGVEIDSAVADGAQAVILP
QVTFGIAVRMAVMSMLGSR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacccccagctcaaccagcacggcgaactgcagcacctgctcacgctcgacggt
ctgccgcgcaacatcctgaacgccatcctcgacaccgccgcgcccttcaccgaggtggcc
gagcgcgaggtcaagaagctgccgctcttgcgcggcaagagcgtgttcaacctgttcttc
gagaactccacacgcacccgcaccaccttcgagatcgccgccaagcgcctctcggccgac
gtggtgaacctcaacatcaacaccagctcggccgccaagggcgagagcctgctcgacacc
gtcgacaacctgtgcgcgatgcaggccgacatgttcgtcgtgcgccacgccgccagcggt
gcgccgatgctgatcgcccagcacctgcagaacaccgggcgcgaccacatccacgtggtc
aacgccggcgacggccgccatgcgcacccgacgcagggcctgctcgacatgtacaccatc
cgccacttcaagaaggacttcaccaacctgaccgtggcgatcgtcggcgacgtgctgcac
tcgcgtgtggcgcgcagccagatcgccgcgctgaccacgctcggcgtgcccgaagtacgc
gtgatcggcccccggaccctgctgcccaccgaggtcgagaagcttggcgtgcgcgtgttc
cacgacatgcgcgaggggctgaaaggggtggacgtggtgatgatgctgcgcctgcagaac
gagcgcatgaacggcgcgctgctgcccacgccgcaggagtactacaagatctggggcctc
accgccgagaagctcgcgctcgccaggcccgacgcgatcgtgatgcaccccggcccgatg
aaccgcggcgtggagatcgactccgcggtggccgatggcgcgcaggcggtcatcctgccc
caggtcaccttcggcatcgccgtgcgcatggcggtgatgagcatgctcggcagccgctga

DBGET integrated database retrieval system