KEGG   Thauera sp. MZ1T: Tmz1t_3764Help
Entry
Tmz1t_3764        CDS       T00804                                 

Definition
phosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
tmz  Thauera sp. MZ1T
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tmz1t_3764
Enzymes [BR:tmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Tmz1t_3764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4150423..4151013
Genome map
AA seq 196 aa AA seqDB search
MQLHLIRHPRPAVEPGICYGQTDLGLAESPAAVAERLRPLLPESFALHASPLARARLLAE
SLGRPRLDERLKEIHFGDWEGRSFTDIGSAIDDWAADPLGFRPPGGESPREMATRVLQWL
AEHGLTPRTPDAAGIRASPPLPDALVVVAHGGPLRAIAGHLLGMPPERWIGLDFGCGQVT
RIDVEDWGTVLRWFNR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcacctgatccgccacccccgcccggccgtcgagccgggaatctgctacggc
cagaccgacctcggcctggccgaatcgcccgccgcggtggccgagcgcctgcgcccgctg
ctgcccgaatccttcgcactgcatgccagcccgctcgcgcgcgcgcgcctgcttgccgag
tcgctgggtaggccgcgcctcgacgaaaggctcaaggagatccacttcggcgactgggag
gggcgcagcttcaccgacatcggcagcgccatcgacgattgggcggccgacccgctgggt
tttcggccgccgggcggagagtccccgcgcgagatggcgacgcgcgtgctgcagtggctg
gcggaacatgggctcacccctcgaacgcccgatgcggcgggaatcagggccagcccccca
ttgccagacgcgctggtcgtcgtggcccacggcgggccgctgcgggcgattgccgggcac
ttgctgggcatgccgcccgaacgctggatcgggttggacttcggctgcgggcaggtgacg
cggatcgacgtggaagactggggaacggtgctgaggtggttcaatcgctga

DBGET integrated database retrieval system