KEGG   Thauera sp. MZ1T: Tmz1t_4073Help
Entry
Tmz1t_4073        CDS       T00804                                 

Definition
uracil-DNA glycosylase superfamily
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
tmz  Thauera sp. MZ1T
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Tmz1t_4073
Enzymes [BR:tmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Tmz1t_4073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4471896..4472651
Genome map
AA seq 251 aa AA seqDB search
MTARILIDAARELSAAVDALPFAPPVTHVYNPLDYAWEVHRRYLERYGDGRRRVVFVGMN
PGPFGMAQIGVPFGEIASARDWLGLEGPVGQPLIVNPKRPVEGFACARSEVSGQRLWGLF
RARYGAPEAFFAEHFVANYCPLVFFEGGRNLTPDKLPVAEQRPLLAACDAHLRILVGALQ
PEWVIGIGNWAEKRASEALAGLPGVKFGRVLHPSPASPAANRGWAEAATRQLTELGGLAQ
LGVCAAEAKRR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcatcctgatcgacgccgcccgcgaactctccgcggcggtggacgcactc
cccttcgctccgcccgtgacccacgtgtacaacccgctcgactacgcctgggaggtgcac
cgacgctacctcgagcgctatggcgacggccgccggcgggtggtcttcgtcggcatgaac
cccggccccttcggcatggcgcaaatcggcgtgcccttcggcgagatcgccagcgcgcgc
gactggctggggctggagggcccggtcgggcagccgctcatcgtcaacccgaaacggccg
gtggagggcttcgcctgcgcgcgctcggaggtcagcggccagcgcctgtggggcctgttc
cgcgcccgctatggcgcacccgaggccttcttcgccgagcacttcgtcgccaactactgc
ccgctggtgttcttcgagggtggccgcaacctcacccccgacaagctgccggtggccgag
cagcgcccgctgctggcggcctgcgacgcgcatctgcgcatcctggtcggggcgctgcag
cccgagtgggtgatcggcatcggcaactgggcggaaaagcgcgccagcgaggcgcttgcc
ggcctgcccggggtgaagttcggccgcgtgctgcaccccagccccgccagccctgccgcc
aaccgcggctgggccgaggcggcgacgaggcagctgacggagctggggggtctggcgcag
ctaggagtctgcgcggcagaagccaagcgtcggtga

DBGET integrated database retrieval system