KEGG   Thermotoga neapolitana: CTN_0032Help
Entry
CTN_0032          CDS       T00847                                 

Definition
Putative dTDP-6-deoxy-D-glucose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tna  Thermotoga neapolitana
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CTN_0032
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CTN_0032
Enzymes [BR:tna01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CTN_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26426..26992
Genome map
AA seq 188 aa AA seqDB search
MKVMETDLPGVLIIEPRVFEDERGWFMESYSYRVFKELGIDAVFVQDNHSYSKRKGTLRG
IHFQNNPVAQAKLVRCTRGKILDVAVDLRKGSPTYKKWIMVELSEENKRMLFIPKGFGHA
FLTLTDDVEVQYKVDQYYSKEHDRSIRWNDPDIGIDWPIEEPILSEKDRNAPFLKDSDCN
FVYGGDEQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcatggaaacagatttgccaggagttttgattatagaacccagagtctttgaa
gacgaacgtggctggttcatggaaagttattcttacagagtattcaaagagcttggaata
gatgctgtgttcgtccaggataatcactcctactctaagagaaaaggaactctccgggga
atacacttccagaataatccggtggcacaggcaaagctagtaaggtgtacaaggggaaaa
atcctcgatgtggcagttgacttgagaaagggttcacccacgtacaaaaaatggatcatg
gtagaactctcagaggagaacaaaaggatgctcttcattccaaaaggctttggtcatgcc
ttcctaactctcaccgatgatgtagaagtgcagtacaaagtcgatcaatactactcgaaa
gaacatgacagaagcatcagatggaacgacccggatatagggatcgactggccaatagaa
gaacctatcctctcagaaaaggacagaaacgctccgtttttaaaagacagtgactgtaac
tttgtctatggtggtgatgaacagtga

DBGET integrated database retrieval system