KEGG   Thermotoga neapolitana: CTN_0131Help
Entry
CTN_0131          CDS       T00847                                 

Definition
(GenBank) Tryptophan synthase beta chain 2
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tna  Thermotoga neapolitana
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTN_0131
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTN_0131
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTN_0131
Enzymes [BR:tna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTN_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
123660..124313
Genome map
AA seq 217 aa AA seqDB search
MRKHMMNLFGGKVTPSPSEETNFGKKILSEDPDNPGSLGIAISEALEVAVSDPNTKYSLG
SVLNHVLLHQTVIGLEIKKQLELIGEKPDILLGCHGGGSNFGGTILPFIPEKLSGENIRF
VACEPTACPSLTRGKYDYDFGDTAGLTPLLKMYTLGKDFIPPKIHAGGLRYHGSAPIIAR
LVKEGSKESERRRKRTCDSIHSERPRSARSHSVRVRR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcacatgatgaatctgttcggaggaaaggtaactccaagccccagtgaagaa
acgaacttcggaaagaagatcctgagtgaagatccagacaatccaggtagtcttggcatc
gccatcagtgaggcactggaagtggccgtgtctgatccgaacacgaagtactccctcgga
agcgtattgaaccatgttctgctccaccagacggttataggcctcgagatcaagaaacag
ctcgaactcataggtgaaaaaccagacatcttactgggatgtcacggaggaggctcgaat
tttggaggaacgatccttcccttcataccggaaaaactttctggagagaacatcagattc
gttgcctgcgaaccgaccgcctgtccttcactgaccagaggaaagtacgactacgacttc
ggagacacggccggcctcacaccccttctcaagatgtacacgctcggaaaagacttcatt
ccaccgaagatacacgcgggtgggctcagataccatggttctgcaccaataatagcaaga
ctcgtgaaagagggaagcaaagaaagcgaaagaagaaggaaaagaacgtgtgatagtatt
cactctgagcggccacggtctgctcgatctcacagcgtacgtgtgaggaggtaa

DBGET integrated database retrieval system