KEGG   Thermotoga neapolitana: CTN_0389Help
Entry
CTN_0389          CDS       T00847                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tna  Thermotoga neapolitana
Pathway
tna00330  Arginine and proline metabolism
tna00332  Carbapenem biosynthesis
tna01100  Metabolic pathways
tna01130  Biosynthesis of antibiotics
tna01230  Biosynthesis of amino acids
Module
tna_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CTN_0389
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CTN_0389
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CTN_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACM22565
UniProt: B9KC19
Position
complement(382352..383407)
Genome map
AA seq 351 aa AA seqDB search
MKIVVKVGSNLLVGSSGLRKSYIAELCREVAHLKKQGHEVAIITSGARAAGFTYLGKGKK
TQDLHTKQALCAVGQVQLMKVYENAFDFYGIKIAQILLTRDTFSDRKRYLNLRNTLIGLS
EFDVVPIVNENDTVATEEITLGDNDTLAAMFSIAWDADILVLFTTVDGVIDKYGKLVERF
DESVELKDLGKSSWGTGGIRSKIEAALMASRCGVKVTICNGNDLSNLTRFVRGESVGTVF
EPRERLRAKKAWIAFLSEPSGRIYVNEGAEQALKNGGSLLPVGVVRVEGNFDVGDVVEIV
NEKGELVGRGIVNYSSSDLEKISGHRSSDLKKILGYEGSKVVVHIDNMWLA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgtcgtgaaagtgggaagcaatcttcttgttggaagttctggcctgaggaaa
tcttacatcgcagaactctgccgtgaggtcgcccatttgaaaaagcagggacacgaagtt
gccatcatcacctccggtgcccgcgcagcgggctttacctatctcggaaaaggaaaaaaa
acacaggatcttcacacgaagcaggctctctgtgcggtgggacaggtacaactcatgaag
gtctacgagaacgccttcgacttttacggcatcaagatcgctcagatcctgctcacaagg
gacaccttctcggacagaaaaagatacctcaacctccgaaacacactgataggactttct
gagttcgacgttgtaccgattgtgaacgagaacgacaccgttgcgaccgaggagatcacg
ctcggtgacaacgacacgctcgccgcgatgttttcgatagcgtgggatgcggatattctt
gtacttttcacaacggtggatggggttatagacaaatatggaaaactcgtcgaaaggttc
gacgaatccgtggagttgaaggatcttggaaaaagcagctggggaacgggtggtatcaga
tccaagatagaagccgctctgatggcttcaaggtgtggtgtgaaagtgacgatctgcaac
ggaaacgatctctccaacctcaccaggtttgtgagaggagaatccgttggtactgtcttt
gaacccagggagcgactgagggcaaaaaaggcatggatcgcttttctttcggagccgtcc
gggaggatatacgtgaacgagggagcagaacaggctctcaagaatggaggaagtttgctt
cccgtcggtgttgttcgtgttgagggaaacttcgatgtaggggacgttgtggagatagtg
aacgagaagggagaacttgtgggccgcgggatcgtgaactactcctcatcggatcttgag
aagatatctggccacagaagttccgatttgaagaaaatactgggctacgaaggaagcaag
gtggtcgttcacatagacaacatgtggcttgcatga

DBGET integrated database retrieval system