KEGG   Thermotoga neapolitana: CTN_0395Help
Entry
CTN_0395          CDS       T00847                                 

Definition
6-phosphofructokinase, pyrophosphate-dependent
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_0395
   01230 Biosynthesis of amino acids
    CTN_0395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0395
   00030 Pentose phosphate pathway
    CTN_0395
   00051 Fructose and mannose metabolism
    CTN_0395
   00052 Galactose metabolism
    CTN_0395
  Energy metabolism
   00680 Methane metabolism
    CTN_0395
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTN_0395
Protein phosphatases and associated proteins [BR:tna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTN_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387752..389011
Genome map
AA seq 419 aa AA seqDB search
MAEKLGILVGGGPAPGINSVISAVTIEAINNGLEVIGIYDGFKHLVEGKTNMVKKLTIED
VSRIHIEGGSILRTSRVNPAKSEETLEKTIQALKKLGIKYLVTIGGDDTAFSASKVSERS
RGEIKVVHVPKTIDNDLPLPENMPTFGFETARHVATELVYNLMQDSRTTDRWYFVAMMGR
EAGHLALGVGKAASATITIIPEEFREGVTLEEVCDVLDGAILKRKLMGRNDGVAVIGEGI
AEKMDPEELANIPGVIVEKDPHGHLRLAEIPLATILKRAIEKRFAERGEKIHIVDVTIGY
ELRSARPIPFDIVYTRTLGYGAVRFLLGDYSDLPGGMVCVVGGRIKILPFDAFMDPKTGR
TRVRLVDVRSEDYRVARKYMIRLEKKDLEDPETLEKLAKLAKMEPEEFKKKYWHTTELP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaaaattagggatactcgttggaggaggaccggcacctggtatcaacagtgtg
atcagtgctgtcaccatcgaagccataaacaacggtcttgaggtgatcggcatctacgat
ggtttcaaacatctggtggaaggaaaaacgaacatggtgaaaaagctcaccatcgaagat
gtgtccagaattcacatcgaaggaggttccatcctcagaacctcaagggtgaaccccgca
aaatccgaagagacacttgagaaaaccattcaggccctgaagaaactgggaataaagtac
ctcgtcacgatcggaggggacgacactgccttctccgcgagcaaggtgagtgaaagatcc
agaggagaaataaaggtggtccacgttccaaagacgatagacaacgaccttcctcttcca
gagaacatgcctacctttggctttgagacggcacgacacgtggcaacagaactcgtctac
aacctcatgcaggactcaagaacaacagacagatggtactttgtggcgatgatgggaagg
gaagcgggacaccttgccctcggcgtgggaaaagctgcgagtgcaacgatcaccatcatt
cccgaagagttcagagagggtgtgactctcgaggaggtatgcgacgttctcgatggagcg
atcctgaagagaaaacttatgggaagaaacgacggggttgcggtcataggtgaaggaatc
gcagagaagatggatccggaagaacttgccaacattccaggagtgatagtggaaaaagat
ccacacggccatctgaggctcgctgaaatcccacttgcaacgatcctgaagagggccata
gagaaaaggttcgctgagaggggagaaaagatccatatcgtcgatgtcacgataggttac
gagctcagaagcgcaagacccattccgttcgacatcgtctacaccagaacactcggatac
ggcgctgtgagatttctccttggagactactcggaccttccgggtggcatggtgtgtgtt
gtcggaggaaggataaagatcctgccgttcgatgccttcatggacccgaagaccggtaga
accagggtgagactggtggatgttcgatcggaagattacagagtagcaagaaaatacatg
ataaggctggaaaagaaagatctcgaagatcccgaaactctcgaaaaactagcaaagctc
gcaaagatggaacctgaagaattcaaaaagaaatactggcacacgacagagcttccataa

  All links  
No link information was found.   
DBGET integrated database retrieval system