KEGG   Thermotoga neapolitana: CTN_0395Help
Entry
CTN_0395          CDS       T00847                                 

Definition
(GenBank) 6-phosphofructokinase, pyrophosphate-dependent
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tna  Thermotoga neapolitana
Pathway
tna00010  Glycolysis / Gluconeogenesis
tna00030  Pentose phosphate pathway
tna00051  Fructose and mannose metabolism
tna00052  Galactose metabolism
tna00680  Methane metabolism
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
tna01120  Microbial metabolism in diverse environments
tna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0395
   00030 Pentose phosphate pathway
    CTN_0395
   00051 Fructose and mannose metabolism
    CTN_0395
   00052 Galactose metabolism
    CTN_0395
  Energy metabolism
   00680 Methane metabolism
    CTN_0395
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTN_0395
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CTN_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK HGTP_anticodon SpoOE-like NRDD DUF128 Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACM22571
UniProt: B9KC25
Position
387752..389011
Genome map
AA seq 419 aa AA seqDB search
MAEKLGILVGGGPAPGINSVISAVTIEAINNGLEVIGIYDGFKHLVEGKTNMVKKLTIED
VSRIHIEGGSILRTSRVNPAKSEETLEKTIQALKKLGIKYLVTIGGDDTAFSASKVSERS
RGEIKVVHVPKTIDNDLPLPENMPTFGFETARHVATELVYNLMQDSRTTDRWYFVAMMGR
EAGHLALGVGKAASATITIIPEEFREGVTLEEVCDVLDGAILKRKLMGRNDGVAVIGEGI
AEKMDPEELANIPGVIVEKDPHGHLRLAEIPLATILKRAIEKRFAERGEKIHIVDVTIGY
ELRSARPIPFDIVYTRTLGYGAVRFLLGDYSDLPGGMVCVVGGRIKILPFDAFMDPKTGR
TRVRLVDVRSEDYRVARKYMIRLEKKDLEDPETLEKLAKLAKMEPEEFKKKYWHTTELP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaaaattagggatactcgttggaggaggaccggcacctggtatcaacagtgtg
atcagtgctgtcaccatcgaagccataaacaacggtcttgaggtgatcggcatctacgat
ggtttcaaacatctggtggaaggaaaaacgaacatggtgaaaaagctcaccatcgaagat
gtgtccagaattcacatcgaaggaggttccatcctcagaacctcaagggtgaaccccgca
aaatccgaagagacacttgagaaaaccattcaggccctgaagaaactgggaataaagtac
ctcgtcacgatcggaggggacgacactgccttctccgcgagcaaggtgagtgaaagatcc
agaggagaaataaaggtggtccacgttccaaagacgatagacaacgaccttcctcttcca
gagaacatgcctacctttggctttgagacggcacgacacgtggcaacagaactcgtctac
aacctcatgcaggactcaagaacaacagacagatggtactttgtggcgatgatgggaagg
gaagcgggacaccttgccctcggcgtgggaaaagctgcgagtgcaacgatcaccatcatt
cccgaagagttcagagagggtgtgactctcgaggaggtatgcgacgttctcgatggagcg
atcctgaagagaaaacttatgggaagaaacgacggggttgcggtcataggtgaaggaatc
gcagagaagatggatccggaagaacttgccaacattccaggagtgatagtggaaaaagat
ccacacggccatctgaggctcgctgaaatcccacttgcaacgatcctgaagagggccata
gagaaaaggttcgctgagaggggagaaaagatccatatcgtcgatgtcacgataggttac
gagctcagaagcgcaagacccattccgttcgacatcgtctacaccagaacactcggatac
ggcgctgtgagatttctccttggagactactcggaccttccgggtggcatggtgtgtgtt
gtcggaggaaggataaagatcctgccgttcgatgccttcatggacccgaagaccggtaga
accagggtgagactggtggatgttcgatcggaagattacagagtagcaagaaaatacatg
ataaggctggaaaagaaagatctcgaagatcccgaaactctcgaaaaactagcaaagctc
gcaaagatggaacctgaagaattcaaaaagaaatactggcacacgacagagcttccataa

DBGET integrated database retrieval system