KEGG   Thermotoga neapolitana: CTN_0449Help
Entry
CTN_0449          CDS       T00847                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--LD-lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tna  Thermotoga neapolitana
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CTN_0449
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTN_0449
Enzymes [BR:tna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CTN_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442310..443782
Genome map
AA seq 490 aa AA seqDB search
MTISTIASILKDQILKVNAPMDLEISGISNHTSRVKKGDLFICRKGEKFDSHEIIPEVIE
KGAVAVVVEREVNFDAPSILVFDSRYFEAKLASLFFEDPWKDTLTFGITGTNGKTTTTLM
IYHMLTSMGVKGSALTTVLKNVLGKTYYEDITTPDAITVLSAMKENKDGGGRFFALEVSS
HALVQKRVEGVRFDVGIFTNISRDHLDFHGTFENYLKAKLHLFDLLKDDGFAVLNESLSD
ALHRRVRKVTFGTSRNANYRLGNIEVSWEGTSFVLETPDGFLKVFTRAIGDFNAYNAAAA
IAALHQLGFDPKELAESLESFTGVEGRFEVVKAAKKSGFNVIVDFAHSPDALEKLLKNVR
KISKGRVIVVFGAGGNSDRGKRPMMSRVVSELADVMILTTDDPRGEDPEQIMEDLIKGVD
KNKPYLVLFDRKEAIETALTIANRGDTVVVAGRGHERYQIIDDEKKIPFHDREVIEEILR
EKLRGRKFVQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgactatatcaacaatcgcttcgattttgaaagatcaaattctgaaggtcaacgcccct
atggatctggaaatctccggaatctccaaccacacttccagggtgaagaaaggagatctt
ttcatctgcagaaagggagaaaagttcgactcccatgagataattccagaggttatcgaa
aagggagccgtggccgttgtggtggaaagagaagtgaattttgatgctccaagcatcctg
gtcttcgattcgagatattttgaagcaaagctggcgagcctgttcttcgaggatccctgg
aaggacactctcaccttcggaatcacgggcacgaacggaaaaacgaccacaacgttgatg
atctatcacatgctcacatcgatgggagtgaaagggagcgccctcaccacagtgttaaag
aacgttcttggaaaaacctattacgaagacatcaccactcccgatgcaatcaccgttctc
tccgcaatgaaagaaaacaaagacggtggaggaaggttctttgcccttgaagtgtcttcc
cacgcactcgtacagaagagagtggagggtgtgaggttcgacgttggtatcttcaccaac
atatcacgtgatcatctggatttccacggaactttcgaaaattatctgaaggccaaactc
catctgtttgatcttttgaaggacgatggttttgccgttctgaacgaatctttgtccgat
gcccttcatcgaagggtaaggaaggtcactttcggcacatccagaaatgcaaactacaga
ctggggaacatcgaagtgagttgggagggaacatctttcgtactggaaacaccggatggc
tttctgaaggttttcacaagagccatcggtgatttcaacgcgtacaatgcagcagcggcc
atagccgcccttcaccagctggggttcgatccaaaagaactcgccgaatccctggagagt
ttcacgggggttgaaggaagatttgaggtcgtgaaggcagcaaaaaaatcgggcttcaac
gtcatcgttgactttgcccattcaccggatgccctggagaaactgttaaaaaacgtcaga
aagatatctaagggaagagtgatcgttgtgttcggggcggggggaaacagcgacagaggc
aaacgccccatgatgtcgagagttgtttctgagttagcagatgtgatgatactgacgacg
gacgatccaagaggtgaagatccagagcaaataatggaggatctgataaaaggggtggac
aaaaacaagccctatcttgtgctcttcgatagaaaggaagccatagagacagccctcacg
atagcaaacaggggggacaccgttgtcgtcgctggaagaggtcatgaaagataccagata
atagatgacgaaaagaagatcccgttccacgatagagaggtgatcgaagagatactgaga
gaaaagttaagggggaggaagttcgtccagtga

DBGET integrated database retrieval system