KEGG   Thermotoga neapolitana: CTN_0476Help
Entry
CTN_0476          CDS       T00847                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tna  Thermotoga neapolitana
Pathway
tna00010  Glycolysis / Gluconeogenesis
tna00030  Pentose phosphate pathway
tna00051  Fructose and mannose metabolism
tna00052  Galactose metabolism
tna00680  Methane metabolism
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
tna01120  Microbial metabolism in diverse environments
tna01130  Biosynthesis of antibiotics
tna01200  Carbon metabolism
tna01230  Biosynthesis of amino acids
tna03018  RNA degradation
Module
tna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0476
   00030 Pentose phosphate pathway
    CTN_0476
   00051 Fructose and mannose metabolism
    CTN_0476
   00052 Galactose metabolism
    CTN_0476
  Energy metabolism
   00680 Methane metabolism
    CTN_0476
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CTN_0476
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTN_0476
Protein phosphatases and associated proteins [BR:tna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTN_0476
Messenger RNA biogenesis [BR:tna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CTN_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACM22652
UniProt: B9K6R9
Position
470120..471079
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRYGIKNGLEVIGVRRGYSGLIDGDFVKLEYKDVAGI
TEKGGTILRTSRCEEFKTEEGREAAAKQLKKHGIEGLVVIGGEGSLTGAHLLHEEHNIPV
VGIPATIDNDIGLTDMCIGVDTCLNTVMDAIQKLKDTASSHERAFIVEVMGRHSGYIALM
AGLVTGAEAIIIPEIPVDYSQLADRILQERRRGKINSIIVVAEGAASAYTVARHLEYRIG
YETRITILGHVQRGGSPTAFDRRLALSMGVEAVEALLDGEADVMIALQGNKFVRVPIMEA
LSTKKTIDKKLYEIAHLLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaatagcagtgctcacaagtggaggagacgcccctggtatgaacgctgcggtg
cgagcggttgtgaggtacggaatcaaaaacggcctggaagttattggcgtgagaagaggt
tactctggtctcatcgatggagattttgtgaagctcgagtacaaagatgtagcgggtatc
acagagaaaggtggtacgatcctgagaacctcaagatgtgaagagttcaagacggaagaa
ggcagagaagcagcggcaaagcaattgaaaaaacacggaatagaaggcctcgtcgtcatc
ggtggtgagggaagtctcacaggagcacatcttcttcacgaagaacacaacattcccgtt
gtggggattcctgcgaccatagacaacgacatcggactcaccgacatgtgtatcggggtt
gacacgtgtttgaacacggtcatggacgccattcaaaagctgaaggatacggcgagttcc
cacgaaagggcgttcatcgttgaagtcatgggaaggcactcaggttacatagcactcatg
gcgggattggtgacgggagcggaagccatcataattccggaaatccccgtggattactct
caactcgcggacaggatcctccaggagagaagaagagggaagataaacagcatcatcgtt
gttgcagagggtgcagcgagcgcgtacaccgttgcaagacacctcgaatacaggataggc
tacgagacgaggatcacgatactgggccacgttcaaaggggtggttctccaacggcgttc
gacagaagactcgccctgagcatgggagtagaagccgttgaagcccttctggacggtgaa
gcggatgtgatgatcgctcttcagggaaacaaattcgtcagggttcccatcatggaggcg
ctctcaaccaagaagaccatcgacaagaaactctacgaaatagcacacttactctcatga

DBGET integrated database retrieval system