KEGG   Thermotoga neapolitana: CTN_0476Help
Entry
CTN_0476          CDS       T00847                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_0476
   01230 Biosynthesis of amino acids
    CTN_0476
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0476
   00030 Pentose phosphate pathway
    CTN_0476
   00051 Fructose and mannose metabolism
    CTN_0476
   00052 Galactose metabolism
    CTN_0476
  Energy metabolism
   00680 Methane metabolism
    CTN_0476
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CTN_0476
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTN_0476
Protein phosphatases and associated proteins [BR:tna01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTN_0476
Messenger RNA biogenesis [BR:tna03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CTN_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470120..471079
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRYGIKNGLEVIGVRRGYSGLIDGDFVKLEYKDVAGI
TEKGGTILRTSRCEEFKTEEGREAAAKQLKKHGIEGLVVIGGEGSLTGAHLLHEEHNIPV
VGIPATIDNDIGLTDMCIGVDTCLNTVMDAIQKLKDTASSHERAFIVEVMGRHSGYIALM
AGLVTGAEAIIIPEIPVDYSQLADRILQERRRGKINSIIVVAEGAASAYTVARHLEYRIG
YETRITILGHVQRGGSPTAFDRRLALSMGVEAVEALLDGEADVMIALQGNKFVRVPIMEA
LSTKKTIDKKLYEIAHLLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaatagcagtgctcacaagtggaggagacgcccctggtatgaacgctgcggtg
cgagcggttgtgaggtacggaatcaaaaacggcctggaagttattggcgtgagaagaggt
tactctggtctcatcgatggagattttgtgaagctcgagtacaaagatgtagcgggtatc
acagagaaaggtggtacgatcctgagaacctcaagatgtgaagagttcaagacggaagaa
ggcagagaagcagcggcaaagcaattgaaaaaacacggaatagaaggcctcgtcgtcatc
ggtggtgagggaagtctcacaggagcacatcttcttcacgaagaacacaacattcccgtt
gtggggattcctgcgaccatagacaacgacatcggactcaccgacatgtgtatcggggtt
gacacgtgtttgaacacggtcatggacgccattcaaaagctgaaggatacggcgagttcc
cacgaaagggcgttcatcgttgaagtcatgggaaggcactcaggttacatagcactcatg
gcgggattggtgacgggagcggaagccatcataattccggaaatccccgtggattactct
caactcgcggacaggatcctccaggagagaagaagagggaagataaacagcatcatcgtt
gttgcagagggtgcagcgagcgcgtacaccgttgcaagacacctcgaatacaggataggc
tacgagacgaggatcacgatactgggccacgttcaaaggggtggttctccaacggcgttc
gacagaagactcgccctgagcatgggagtagaagccgttgaagcccttctggacggtgaa
gcggatgtgatgatcgctcttcagggaaacaaattcgtcagggttcccatcatggaggcg
ctctcaaccaagaagaccatcgacaagaaactctacgaaatagcacacttactctcatga

DBGET integrated database retrieval system