KEGG   Thermotoga neapolitana: CTN_0522Help
Entry
CTN_0522          CDS       T00847                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tna  Thermotoga neapolitana
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tna03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525040..525615
Genome map
AA seq 191 aa AA seqDB search
MVPVIAGIYGKVVEKNGNTVFVSTNSGIVFEIACDTQTCEELEENRECYLYTFLSVSQDG
VALYGFSDRKKKDLFLSLMKVSRLGPKTALKILSSEDVDTLISMINSQDVEGLSKIPGIS
RKTAERIVMELKGKFESTVLKDLKTYHESLEALVSLGYPEKQARKAIKEVLKDGMSTSEV
IKEALRILSRR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtggtacctgtgatagctgggatctacggaaaagtggtggaaaagaatggaaacaccgtt
tttgtctcaacaaactccggcatagtcttcgaaattgcatgcgatacacagacatgcgag
gaactcgaggagaatagggagtgttatctgtacacgttcctgagcgtctctcaggatggt
gttgctctctacggtttttcggataggaaaaagaaggatctttttctttctctgatgaaa
gtctcaaggcttggtcccaagacagccctgaagatactttcgagtgaggacgtggacacc
ctgatatcgatgatcaactcccaggatgttgagggactttcaaagattccgggaatcagc
agaaagaccgccgagcgaatcgtcatggaattgaagggaaagttcgaaagcactgtatta
aaagacctgaagacctaccatgaatccctggaggccctggtttctctcggctatccagaa
aaacaggcaagaaaggccataaaggaagtactcaaggacggcatgtccacgtccgaagtt
atcaaagaagcattaaggattctgagccgcagataa

DBGET integrated database retrieval system