KEGG   Thermotoga neapolitana: CTN_0532Help
Entry
CTN_0532          CDS       T00847                                 

Definition
Alkaline phosphatase precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tna  Thermotoga neapolitana
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTN_0532
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CTN_0532
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CTN_0532
Enzymes [BR:tna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CTN_0532
Exosome [BR:tna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTN_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
533190..534500
Genome map
AA seq 436 aa AA seqDB search
MIQVRRLIVLVLALLLVAFSFSQVKNIIYFIGDGMGLSQAYLTSLIEGRPLSFMKTPYTG
LVKTHSVDSWVTDSAAAGTALASGFKTKNGMINVLPDGTRVPTIFEIAKAYGAKTGIVVT
CRVTHATPAAFYAHVKSRSEENEIARQLVESETVDLVMGGGWANFLPESLGGKRSDGLNL
IEMAKKKGYVYVTKKEDLMKLPENTEKVLALFAPSHLDPASSREEQPMLYEMVKKALEIL
SNDEEPFFLMVEGSQIDWEAHDNDIYGVWKEVVEFDRAVQVALDFALKRGDTLVIVTADH
ETGGLALSSGDYRVDVDRIRKFSKTTDWILANYSLKDRESFKKAIEKYFGLTLSDSDLDR
ITSSNNSKVELGRVLSEKVNVGWTTTSHSGVPVPIYAFGPGAENFTGFLDNTDIPRIMMK
LAGYSLQYPLVKEPVK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgattcaggtgagaagactcatcgtgctggttctggctcttttgctggttgctttttca
ttttcacaggtgaagaacatcatctacttcatcggagacggaatgggactttcacaggcg
tatctcacgagtctgatcgagggaagaccgctctcgttcatgaaaaccccttacacaggt
cttgtgaagacccactctgtggacagctgggtgacggattctgccgccgcgggaactgct
ctggcaagcggttttaagacgaaaaacggtatgatcaacgttcttcccgacggcacaagg
gttcccaccatctttgagatagcaaaagcatatggagccaaaacgggcatcgttgtcacc
tgcagagtgacacatgcgacaccggcagccttctatgcgcatgtcaaaagcagaagcgaa
gaaaacgagatagcaaggcaactcgtggaaagtgaaacagtggatctggtcatgggagga
ggatgggcaaactttcttcctgaaagccttggtggtaaaagatcggacggtctcaatctc
atcgaaatggcgaagaaaaagggctacgtctatgtgacaaaaaaggaagatctgatgaaa
cttccagagaacaccgaaaaggtcctggcgctttttgcgccgagccatcttgacccagca
agcagtagagaggaacagcccatgctctacgaaatggtgaagaaggccctggaaatactc
tcaaatgatgaagagcccttcttcctcatggtggaaggttctcagatcgattgggaagca
cacgacaacgatatctacggtgtttggaaagaagtcgtggagttcgacagagcggttcag
gtggctctcgactttgccctcaaaagaggagataccctcgtgatcgtgacagcagaccat
gaaacaggaggtcttgcactctcttcgggtgactacagggttgatgtggacagaatcaga
aagttctcaaagaccaccgactggatcttggcgaattactctttgaaagatcgcgaaagt
ttcaaaaaggccatcgaaaaatacttcggtctgactctgtccgactcggatctcgacaga
atcacctcttcaaacaattccaaagtagaactcggaagggtgttgagcgaaaaggtgaac
gttggctggaccaccacatcacactccggtgttccggtccccatctatgcattcggtccc
ggtgcggagaacttcacaggatttctggacaacaccgatatcccgaggatcatgatgaaa
ctcgctggatactcccttcagtatccactcgtgaaagaacctgtgaaatga

DBGET integrated database retrieval system