KEGG   Thermotoga neapolitana: CTN_0551Help
Entry
CTN_0551          CDS       T00847                                 

Definition
(GenBank) Tryptophan synthase beta chain 1
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tna  Thermotoga neapolitana
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTN_0551
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTN_0551
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTN_0551
Enzymes [BR:tna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTN_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
552106..553275
Genome map
AA seq 389 aa AA seqDB search
MKGYFGPYGGQYVPEILMPALEELEEAYESITKDESFWEEFNRLLMDYAGRPTPLYFAER
LSKKYGAKIYLKREDLLHTGAHKINNALGQVLLAKRMGKTRIIAETGAGQHGVATATAAA
LFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSRTLKDAINEALRDWITNLQTT
YYVIGSVVGPHPYPIIVRNFQKVIGEETKRQILEKEGKLPDYILACVGGGSNAAGIFYPF
IDSGVKLIGIEAGGEGLNTGKHAASLLKGKVGYLHGSKTLVLQDEWGQVQITHSVSAGLD
YSGVGPEHAYWKETGKVFYDAVTDEEALDAFLELSRLEGIIPALESSHALAYLRKIDIRG
KTVIVNLSGRGDKDLESVLNHPYIRERIG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttacttcggtccttacggtggtcagtacgttccggagatactcatgccagct
cttgaggaactcgaggaagcgtatgaaagcatcacaaaggatgagtctttctgggaggag
ttcaatcgacttttgatggactacgcgggccgtcccaccccactttactttgcagagagg
ttgagcaagaaatacggtgcgaagatctacctgaaacgggaggatcttctccacaccggt
gcccacaagataaacaacgcactcggtcaggtacttcttgcaaaaaggatggggaaaaca
aggataatagcggaaactggtgcgggccagcacggagtggcaacggccaccgctgctgcg
ctctttggcatggagtgtgtcatatacatgggagaggaagacacgatcagacaaaaacct
aacgttgaaagaatgaaactcctcggtgcgaaggtggttcccgtaaaaagcggtagcaga
accctgaaagatgccataaacgaagccctcagagactggataacgaaccttcagaccacg
tactacgtcatcggatccgtggtgggaccacatccctacccgatcatagtgagaaatttt
caaaaggtgataggtgaagagacaaaaaggcagatccttgaaaaagaggggaaacttccg
gattacatcctggcctgtgtaggagggggaagcaacgctgccgggatattctatcccttc
atagacagtggagtgaaactgatagggatagaggcaggtggtgaaggtctcaacacggga
aaacacgccgcttcccttctgaaaggaaaggtggggtaccttcacggaagcaagaccctc
gttcttcaggatgaatggggtcaggttcagataacacactccgtatcggctggtctggat
tattccggggtcggtcccgaacatgcctactggaaggagaccggaaaagtcttctacgac
gctgtgaccgacgaagaagcactggacgccttccttgaactttccaggctcgaggggatc
attcccgctctcgagagttcccatgctctggcctatctgagaaagatagacatcaggggc
aaaaccgtcatcgtgaatctttccgggcgcggtgataaggatcttgaatccgttctcaac
catccgtacatcagggagaggataggatga

DBGET integrated database retrieval system