KEGG   Thermotoga neapolitana: CTN_0553Help
Entry
CTN_0553          CDS       T00847                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tna  Thermotoga neapolitana
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTN_0553 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTN_0553 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTN_0553 (trpA)
Enzymes [BR:tna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTN_0553 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553272..553994
Genome map
AA seq 240 aa AA seqDB search
MKGFIAYIPAGFPDLETTRKVLLALNDLRITGVEVGVPFSDPVADGPVIQLAHSVALRNG
VTMKKILEMLREISVDYELYLMSYLNPIVNYPEGKDRLLDELRRLGVKGLIIPDLPLREV
KNIEISFPIVPFVAPNTRDEDLEAINTIRAPFVYYISRYGVTGEREDLPFAEHIKKVKKK
IALPLFVGFGISRHEQVRKVWEIADGVIVGSALVRIMEESKRQEIPQKVVARVKELIGEK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaagggattcatcgcatacattccagcaggatttcccgatcttgaaaccaccaggaaa
gtcctgctcgctctcaacgatctcagaataactggggtggaagtgggtgttcccttctcc
gatccggttgccgatgggccggtcattcaactggcccacagtgtagccctcaggaacggt
gttaccatgaagaagatcctggaaatgctccgggagatctccgttgattacgaactctat
ctgatgagttacctcaacccgatagtgaactatcctgagggaaaagataggctccttgac
gagttgagaaggctcggtgtgaaggggcttatcattcctgatcttcccttaagagaagtg
aaaaacatcgagatatcttttcccatcgttccttttgtggcaccgaacaccagagatgaa
gacctcgaagcgataaacacgattcgcgcacccttcgtttactacatctccagatacggt
gtcacaggagaaagggaagaccttccctttgcggaacacataaagaaggtgaagaagaaa
atagcacttccgctttttgtaggatttggaatatcaagacacgagcaggtgagaaaggtg
tgggagatagccgacggagtaatcgtcggaagcgcccttgtgaggatcatggaagaaagc
aaaaggcaagagataccacaaaaagtagttgccagagtgaaagaactcattggagaaaaa
tga

DBGET integrated database retrieval system