KEGG   Thermotoga neapolitana: CTN_0580Help
Entry
CTN_0580          CDS       T00847                                 

Definition
(GenBank) Alcohol dehydrogenase, iron-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tna  Thermotoga neapolitana
Pathway
tna00010  Glycolysis / Gluconeogenesis
tna00350  Tyrosine metabolism
tna00625  Chloroalkane and chloroalkene degradation
tna00626  Naphthalene degradation
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
tna01120  Microbial metabolism in diverse environments
tna01130  Biosynthesis of antibiotics
tna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0580
  Lipid metabolism
   00071 Fatty acid degradation
    CTN_0580
  Amino acid metabolism
   00350 Tyrosine metabolism
    CTN_0580
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CTN_0580
   00626 Naphthalene degradation
    CTN_0580
Enzymes [BR:tna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CTN_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK
Motif
Other DBs
NCBI-ProteinID: ACM22756
UniProt: B9K723
Position
complement(577401..578564)
Genome map
AA seq 387 aa AA seqDB search
MFKISCYLPTEIIFRVGAVDELEERAKKLGKKALIVTGRSSTKKTGLLQRVQDLLKKAGV
ESIVFDKIVPNPISDHVDEAAEIVRKEKIDFIVGLGGGSPIDSAKAISITAPNEGKFWDY
VPVGGGKIPEKSIPVVAIPTTHGTGTEADPFAVITNPETKEKVGIGYRNTFPVLSLVDPE
VMKTLPKDQTAYTSMDAFYHAIEAFLNVNANPYSDVLALDAMKRIVTYLPVAYENGEDME
ARTNLAWASTEAGITETLTGVIANHALEHGLSGFYPEITHGLGLCITGPYLFEYIFDHAY
ERLAIVGREVFGVYETDDRKAGKLAIKKLRDFQEMFGLNKRLSELGVKEEDIPKMAETGY
RILNGVVVVTPGNLTAKDMEEIFRRCY
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaatatcatgttatcttccaacagaaataatcttcagagtgggtgcagtagat
gaactggaagagagggcgaagaaactgggaaagaaagcgttgatcgtcactggaaggtcc
agcacgaaaaaaacgggtcttctccagagagtacaggatcttctcaaaaaagcaggcgtt
gaaagcatcgttttcgacaagatcgttcccaacccgatatcggatcatgtggatgaagcc
gcagagatcgtgagaaaagaaaagatagatttcatcgtgggacttggtggtggaagcccc
atagacagtgcaaaggcgatctccatcaccgctccaaacgaaggaaaattctgggactac
gttcccgtgggagggggaaagatccctgaaaagtccatccccgttgttgccattccgacc
acccatggaacgggaacggaagccgacccattcgccgtgatcacaaaccccgaaacgaaa
gaaaaggtgggtatcggctacagaaacaccttccccgttctttccctggtggatcctgag
gtgatgaagacccttcccaaagatcagaccgcttacacttctatggatgcgttctaccac
gccatagaggccttcttgaacgtgaacgcaaatccttactcggacgttctcgctctggat
gccatgaagaggatcgtgacgtatcttcctgtcgcttacgaaaacggagaggacatggaa
gccagaacgaaccttgcctgggcaagcaccgaagcaggtatcacagaaacactgaccggt
gtcatcgcaaaccacgcgcttgaacacggtctcagtggattttacccggagatcacgcac
ggtcttggactgtgcatcacgggaccttatctgttcgagtacatattcgaccacgcctat
gaaagactcgccatcgttggaagagaagtgttcggggtgtacgaaacagacgacagaaaa
gccggaaaactcgccatcaaaaaactcagagacttccaggagatgttcgggttgaacaag
agactgagtgaacttggagtgaaagaagaggacataccaaagatggcagaaaccggctac
aggatattgaatggggttgtcgttgtaacacccgggaacctgacggcaaaggacatggag
gagatattcagaaggtgttactga

DBGET integrated database retrieval system