KEGG   Thermotoga neapolitana: CTN_0583Help
Entry
CTN_0583          CDS       T00847                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tna  Thermotoga neapolitana
Pathway
tna00520  Amino sugar and nucleotide sugar metabolism
tna00550  Peptidoglycan biosynthesis
tna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CTN_0583
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTN_0583
Enzymes [BR:tna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CTN_0583
Peptidoglycan biosynthesis and degradation proteins [BR:tna01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   CTN_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ACM22759
UniProt: B9K726
Position
complement(580750..581949)
Genome map
AA seq 399 aa AA seqDB search
MAASILCDEEIVLENVPKLQDVFVMKDILTSIGFEVMFNGNNLIIKRVKDISQEVPYELV
RKMRASFNVLGPIAARTGGARVALPGGCSIGVRPVDFHLEGLRKLGFSIKVEHGFVEAVL
EKKVKDVTITLPFPSVGATEHLMTTASLLNGSHVVIENAAMEPEIVDLQNFLNAMGGNVK
GAGTSRVEIFGVRKMRGTRYRIIPDRIEAGTYLIAIAASKGEGLVKNLKPEHLTNFLEKL
EQTGATLKIFQDSIEIKMKERPDPVDITTNPYPGFPTDLQPQMMVYLSVAKGVSVITENV
FKTRFLHVDELKRMGADIEVSGNVAIVRGVEKLSGAPVEGTDLRATAALLIAGIIAEGST
EINNVEHIFRGYENVVEKFKKLGAKIEYVPGEVEKDRED
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatccattttgtgcgatgaagaaattgttcttgaaaacgttccaaaactccag
gacgtttttgtcatgaaggacattctgacctcaataggtttcgaagtcatgttcaatggc
aacaatctcatcataaaaagggttaaagatatatctcaggaggtaccatatgaactggtc
agaaagatgcgagcgtctttcaacgtactcggaccgatagccgcgagaacaggaggagca
agggttgctttgcccggtggatgttccatcggtgtgaggcccgttgactttcatctggaa
ggtcttagaaaacttggtttttccataaaagtggagcacggttttgtcgaagccgttctc
gagaaaaaggtaaaggacgttacgatcacacttccgtttccaagcgttggagcaacggaa
cacctcatgacaaccgcatcccttctgaatggatcgcacgttgtcatcgagaacgccgcc
atggaaccagagatcgtcgatcttcagaattttctcaacgcgatgggaggaaacgtgaag
ggagccggtaccagtcgtgtagaaatattcggcgtcaggaagatgagaggaacacgatac
agaatcatcccggatagaatagaagcgggaacatacctgatcgccatcgcagcaagcaaa
ggagaaggactggtaaaaaacctgaaacccgagcatctcacgaactttcttgaaaaactc
gaacaaacgggtgctaccttgaagatcttccaggattccatagagataaagatgaaagaa
aggccagacccggtggacatcacaacgaatccctacccgggctttcccaccgatcttcag
ccccagatgatggtgtacctttctgtggcgaagggagtttcagtcatcaccgagaacgtg
ttcaaaacaagatttctgcacgttgatgaactgaaaagaatgggagcggacatagaggta
tccggaaacgtcgccatagtgagaggtgtggaaaaactcagtggagctcctgttgaggga
acagatctgagggcaacagccgcccttctcatagcaggtatcatcgcggaaggttccacg
gagataaacaacgttgaacacatattcaggggttacgaaaacgttgtggagaaattcaaa
aaattgggagcaaagatcgaatatgttccgggagaagttgaaaaggatcgagaagattga

DBGET integrated database retrieval system