KEGG   Thermotoga neapolitana: CTN_0632Help
Entry
CTN_0632          CDS       T00847                                 

Definition
Endo-1,4-beta-xylanase A precursor
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tna  Thermotoga neapolitana
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(632704..635883)
Genome map
AA seq 1059 aa AA seqDB search
MCGFMRKKRRGFLNASTAVLVGILAGFLGVVLAATGALGFGGKGVSPFETVLVLSFEGNT
DGASPFGKDVVVTASQDVAADGEYSLKVENRTSVWDGVEIDLTGKVNTGTDYLLSFHVYQ
TSDSPQLFSVLARTEDEKGERYKILADKVVVPNYWKEILVPFSPTFEGTPAKFSLIITSP
KKTDFVFYVDNVQVLTPKEAGPKVVYETSFEKGIGDWQPRGSDVKISISPKVAHSGKKSL
FVSNRQKGWHGAQISLKGILKTGKTYAFEAWVYQESGQDQTIIMTMQRKYSSDSSTKYEW
IKAATVPSGQWVQLSGTYTIPAGVTVEDLTLYFESQNPTLEFYVDDVKVVDTTSAEIKLE
MNPEEEIPALKDVLKDYFRVGVALPSKVFINQKDIALISKHFNSITAENEMKPDSLLAGI
ENGKLKFRFETADKYIEFAQQNGMVVRGHTLVWHNQTPEWFFKDENGNLLSKEEMTERLR
EYIHTVVGHFKGKVYAWDVVNEAVDPNQPDGLRRSTWYQIMGPDYIELAFKFAREADPNA
KLFYNDYNTFEPKKRDIIYNLVKSLKEKGLIDGIGMQCHISLATDIRQIEEAIKKFSTIP
GIEIHITELDISVYRDSTSNYSEAPRTALIEQAHKMAQLFKIFKKYSNVITNVTFWGLKD
DYSWRATRRNDWPLIFDKDYQAKLAYWAIVAPEVLPPLPKESKISEGEAVVVGMMDDSYM
MSKPIEIYDEEGNVKATIRAIWKDSTIYVYGEVQDATKKPAEDGVAIFINPNNERTPYLQ
PDDTYVVLWTNWKSEVNREDVEVKKFVGPGFRRYSFEMSITIPGVEFKKDSYIGFDVAVI
DDGKWYSWSDTTNSQKTNTMNYGTLKLEGVMVATAKYGTPVIDGEIDDIWNTTEEIETKS
VAMGSLEKNATAKVRVLWDEENLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGY
YEDDDAQFRVNYMNEQSFGTGASAARFKTAVKLIEGGYIVEAAIKWKTIKPSPNTVIGFN
VQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgggttcatgcgaaagaaaagacggggatttttgaatgcttcaaccgcagtgctg
gtaggtatccttgcaggttttctcggagtggtccttgcagccacaggagctctgggattc
ggcggtaagggagtctctccttttgaaacagttcttgtcctgagttttgaagggaacaca
gacggtgcttccccctttggaaaagacgtggttgtcaccgcttcacaggatgttgcagca
gatggagaatactcactgaaagtggaaaacagaacttccgtatgggatggagtagagatc
gatttgaccggaaaggtcaacacaggaaccgattatctgctttccttccatgtctatcag
acttccgattctccgcaacttttcagcgttcttgcaagaacggaagacgaaaagggtgaa
aggtacaagatactggccgacaaggtcgtggtaccgaattactggaaggagatccttgtt
ccattctcgccaaccttcgaaggtactccagcgaagttctctctgatcatcacctcaccc
aagaagacagatttcgtcttctacgtggacaacgtccaggtcctcacgccaaaggaagca
ggcccgaaggttgtttacgaaacctcctttgaaaagggcattggagactggcagccaaga
ggcagtgacgtgaagatttccatttctccaaaagtggcacactctggaaagaaatcactc
ttcgtttccaacagacaaaaaggctggcacggagctcaaatcagtttgaagggaatcctg
aaaaccggaaagacttacgccttcgaagcatgggtctatcaggaatccggtcaggatcag
acgatcatcatgacgatgcagagaaagtactcgtccgattcaagcacaaaatatgagtgg
atcaaagcggcaactgttccttcaggacagtgggttcaactgtctggaacgtacacaatc
cctgccggtgtgaccgtggaagacctcacgctctactttgagtctcagaatccgaccctt
gagttctacgtggacgatgtgaaagtagtggacaccacttctgccgagataaagctcgag
atgaatccggaagaagagatacccgctctcaaggacgttctcaaggattacttcagagtg
ggtgttgcacttccgtccaaggtcttcatcaaccagaaggacatagcgctcatctccaaa
cacttcaacagcatcaccgccgagaacgaaatgaaaccagacagtttgcttgcaggtatc
gaaaacggcaaactcaaattcaggtttgagacagccgacaagtacatcgaattcgcacag
caaaacggcatggttgtgaggggccacacactggtatggcacaatcagacacccgagtgg
ttcttcaaagacgaaaatggaaaccttctgagcaaagaagagatgacagaaaggctcaga
gaatacatacacaccgttgttggacacttcaaggggaaggtctacgcatgggacgttgtg
aacgaagcggtcgatccaaaccagccggatggactgagaagatcgacgtggtatcagatc
atggggcctgactacatagaacttgcgttcaagtttgcaagggaagcagatcccaatgcg
aaactcttctacaacgactacaacaccttcgaacccaaaaagagagacatcatctacaac
cttgtgaagagtctcaaggagaaaggactcatcgatggaataggcatgcagtgtcacatc
agtcttgcaacggacatcaggcagatcgaagaggccatcaaaaagttcagcactatcccc
ggtatagaaattcacataaccgaactcgatataagcgtctacagagattccacttccaac
tactcagaagcaccaaggacagctctcatcgagcaggcccacaagatggcacaacttttc
aagatcttcaagaagtacagcaacgtgatcacgaacgtcacgttctggggtctcaaagac
gactactcctggagggcaacaagaagaaacgactggccactgatctttgacaaagattat
caggcaaaactcgcttactgggcgattgtggctcccgaagtacttccaccccttccaaaa
gagagcaagatctccgaaggagaagcagtggtggtgggaatgatggacgattcctacatg
atgtcgaagccgatagagatctacgatgaagaagggaacgtgaaggcaacgatcagggcg
atatggaaagacagcacgatctacgtatacggagaggttcaggacgcgacgaagaagcca
gcggaagatggagtagcgatcttcatcaacccgaacaacgaaagaacaccatacctgcag
ccggatgacacctacgttgtgctgtggacgaactggaagagtgaggtcaacagggaagac
gtagaggtgaagaaattcgttgggcctggattcaggaggtacagttttgagatgtcgatc
acgatacctggtgtggagttcaagaaagacagttacatagggttcgatgtagcggtgata
gacgacgggaaatggtacagctggagcgacacgacgaacagccagaagacgaacacgatg
aactacggaacgctgaaacttgagggagtgatggtggcgacggcgaaatacggaacaccg
gtcatcgatggagagatcgacgatatctggaacacgacggaggagatagagacgaaatcg
gttgcgatgggatcactggagaagaacgcaacggcgaaggtgagggtgctgtgggacgag
gagaatctgtacgttcttgcgatagtgaaggatccggttttgaacaaagacaacagcaat
ccttgggagcaggattcggtggagatcttcatagacgagaacaaccacaagacaggttac
tacgaagacgatgatgcgcagttcagggtgaactacatgaacgagcagtcgtttgggacg
ggagcgagtgcggcaaggttcaagacggcggtgaagttgatcgaaggaggctacatagta
gaggcggccatcaagtggaagacgatcaagccgagtccgaacacggtgataggcttcaac
gtgcaggtgaacgatgcgaacgagaagggtcagagggttggtatcatctcctggagtgat
ccaacgaacaacagctggagagatccttcaaagttcggaaatctcaggctcatcaagtga

DBGET integrated database retrieval system