KEGG   Thermotoga neapolitana: CTN_0635Help
Entry
CTN_0635          CDS       T00847                                 

Definition
Binding-protein-dependent transport systems inner membrane component
Orthology
K02034  
peptide/nickel transport system permease protein
Organism
tna  Thermotoga neapolitana
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
638504..639622
Genome map
AA seq 372 aa AA seqDB search
MIGVWKKRKNKEKVEELYLASEWKLMWWRFKKNKLAIIGLIILGILYVLGIFCEFFSPYD
PNRIFARYVYAPPQRIHFFHEGKFIGPFVYGYKMERDPETFRRIYKEDRTKIYRIKFFVH
GDKYKLWNVWESNIHFFGVEDGVVFLFGTDRLGRDVFSRILYGARISTTIGLVGVFISMV
LGIVIGGISGYYGGKVDNFIQRVIEFIISIPTIPLWMALAAALPRYWSQIKVYFAITVIL
SLIGWTGLARVVRSKFLSLKEEDFVVAARLAGASEWRIIFKHMLPSLTSHLIASATLAVP
GMILGETGLSFLGLGLRPPAISWGVLLQEAQNIRTVALYPWLLIPGLFVIVTVLCFNFVG
DGLRDAADPYKT
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtgtgtggaagaagcggaagaacaaggaaaaggtggaggagttgtatcttgcg
tccgagtggaagttgatgtggtggaggttcaagaaaaataaactcgcgatcattggtctg
atcatcttagggattctctacgtgctgggaattttctgtgagttcttctccccatacgac
ccgaacagaatcttcgcaagatacgtgtacgctcctcctcagaggatacactttttccac
gagggaaaattcataggcccgttcgtttatggttacaagatggaaagagatccggagact
ttcagaaggatctacaaagaagacagaacgaagatatatagaattaaattcttcgtccat
ggtgacaagtacaaactctggaacgtctgggagtcaaatattcatttcttcggagtggaa
gatggtgtggtctttctctttggaacggacagactcggaagggatgttttctccagaatc
ctgtacggtgcgagaatctccaccacgatcgggctggtcggggtgttcatcagcatggtt
ctggggatcgtcatagggggcatctccggatactacggaggcaaggttgacaacttcata
cagagggtaatagagttcatcatcagtattccgaccattcctctctggatggcgctcgct
gctgctcttccaaggtactggtctcagataaaggtttacttcgctatcacggtgattctc
tcgctgataggctggactggacttgcaagggttgtgaggagtaagtttctctctctcaaa
gaagaggatttcgttgttgcggcaagactcgctggagcctccgaatggagaatcatattc
aaacacatgctgccatctctgaccagtcatctcatagcatctgccacgctcgctgttcct
ggaatgatactgggtgagacggggctcagtttccttggtctggggttgaggccacctgct
attagctggggagttctccttcaggaagctcagaacatcaggaccgttgcactctacccg
tggcttttgatacccggtctgtttgtgatcgtcaccgttttgtgcttcaacttcgtcgga
gacgggctgagggacgccgccgatccatacaagacgtga

DBGET integrated database retrieval system