KEGG   Thermotoga neapolitana: CTN_0650Help
Entry
CTN_0650          CDS       T00847                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tna  Thermotoga neapolitana
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTN_0650
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CTN_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(655030..655485)
Genome map
AA seq 151 aa AA seqDB search
MVIALGSNLGDREMNLKTAIVKMKGRCMYIEKLSSFVETEPYGYTDQPKFLNAVCLVETD
LSPRTLLNTLLEIEREMGRVRTVKWGPRVIDLDIVFYEDLIVNEEGLIIPHPDAHNRLFV
LEPLSEIAPDLVHPVLKKTVQELLIELKQRI
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatagcactcggaagcaacctgggagacagagagatgaacctgaaaacagccatt
gtgaagatgaaaggacgctgtatgtatatcgaaaaactctcctcgttcgttgaaacggaa
ccctatggatacaccgatcagccaaagtttctgaacgctgtgtgccttgtggaaacagat
ctttcaccccgaacccttcttaacactcttcttgagatagaaagagaaatgggaagggtc
agaacggtcaaatggggccccagggtgatagatctcgatatcgtgttctatgaagatctc
atcgtgaacgaggaaggattgatcataccacatcctgacgctcacaacagactcttcgtt
ctggaacccctgagcgaaatagctccggacctcgttcatcctgttttgaaaaagaccgtg
caagaactgctgatagaactcaaacaacgaatatag

DBGET integrated database retrieval system