KEGG   Thermotoga neapolitana: CTN_0680Help
Entry
CTN_0680          CDS       T00847                                 

Definition
(RefSeq) Pyruvate synthase subunit porB
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_0680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0680
   00020 Citrate cycle (TCA cycle)
    CTN_0680
   00620 Pyruvate metabolism
    CTN_0680
   00640 Propanoate metabolism
    CTN_0680
   00650 Butanoate metabolism
    CTN_0680
  Energy metabolism
   00680 Methane metabolism
    CTN_0680
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTN_0680
Enzymes [BR:tna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTN_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(682905..683879)
Genome map
AA seq 324 aa AA seqDB search
MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEV
STTIYPYTAWSVPYIHNAFENVAATMSGVETAYRALKNKGKIPEDKKYAFIAFGGDGGTY
DIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLK
KNIVEIVAAHENVYAATAALSEPMDFFAKVEKALNFDGPSFLAVLSPCVRFWRVNDDKTV
EISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLRAQGRFRKLLSRPDAKEIIDEL
QEYVDRRWERLLALEEATKDKPIR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttaacataaaacaactggcacaggagttcgacaagaaggaaataggtatcaca
cagggtcacagactctgtcccggatgtggtgctccaatcacggtcaaattcgttatgatg
atcgcaagacaccttggatacgaacccgttgttggactagcgacaggttgtctggaggtt
tccaccaccatctatccctacaccgcctggagcgttccctacatccacaacgccttcgaa
aacgtagcagcaacgatgagcggtgtagaaaccgcttacagggctcttaagaacaaagga
aagattccagaagacaaaaagtacgctttcatcgcgttcggaggagacggaggaacgtac
gatataggacttcagtcactctccggtatgcttgaaagaggccacaaggtgctttatgtc
ctctacgacaacgaaggttacatgaacacaggaaaccagagatccggttccacaccaccg
ggttctgacaccacaacggctcccgttggaaagaaactccccggaaaagtccagttgaaa
aagaacatcgtcgagatcgtggcagcccatgagaacgtctacgccgcaactgccgccctg
tccgagccaatggacttcttcgccaaggtggaaaaggcactgaacttcgacggaccttct
ttccttgcagtgctctccccctgtgtcaggttctggagggtgaacgacgacaaaacggtt
gagatctcaaaactcgcagtggaaacaaagtactggcccctgtacgaagtggaaagggga
gtttacagagtcacaagaaagccaagacagttcaaacccgtggaggaatttctgagggcc
caaggaaggttcagaaaactgctttcaagacccgacgcgaaagagatcatagatgaactt
caggaatacgtcgacagaagatgggaaaggctccttgcgctggaagaggccacaaaagac
aaaccgatcagatga

DBGET integrated database retrieval system