KEGG   Thermotoga neapolitana: CTN_0681Help
Entry
CTN_0681          CDS       T00847                                 

Definition
(GenBank) Pyruvate synthase subunit porA
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_0681
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0681
   00020 Citrate cycle (TCA cycle)
    CTN_0681
   00620 Pyruvate metabolism
    CTN_0681
   00640 Propanoate metabolism
    CTN_0681
   00650 Butanoate metabolism
    CTN_0681
  Energy metabolism
   00680 Methane metabolism
    CTN_0681
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTN_0681
Enzymes [BR:tna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTN_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(683894..685078)
Genome map
AA seq 394 aa AA seqDB search
MKMERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGIVKTEMIP
VESEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPI
NIHCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHSDVRLPVMVNLDGFILSHG
VEPVEFYPDDLVKKFVGELKPMYPLLGTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKV
FPEIAKEFEETFGRKYWFVEPYKLDDAEHVMVALGSTNSTIKYVVDELREEGHKVGALKI
WMFRPFPKEQLQELLNGRKSVIVLDRAVSFGAEAPLYEAVKSSLYEVAARPSLGSYVYGL
GGRDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggaaagggtcgttgagagagtggccgtcaccggtgccgaagccgttgccaat
gcgatgagacagatagaacccgacgtcgtcgcggcataccccataactccgcaaactccc
atcgtggagtactttgctagattcgtcgcagacggcatcgtcaaaacagagatgataccc
gttgagagcgaacacagtgcaatgagtgccgttgtgggagctgccgccgcaggcgcaagg
gcgatgacggcaaccagtgcgaacggtcttgctctgatgcatgagatcgtttacattgcc
gcgtcctacagacttcccatagtgatgcccgttgtgaacagggccctgagtggtccgata
aacatacattgtgatcacagtgatgcgatggcagaaagagactcaggctggatacagctc
tttgcagagacaaaccaggaggcttacgatttcaccatccttgccgtgagactcgcagaa
cactccgatgtgagacttcccgtcatggtgaacctcgatggattcatcctctcccacggg
gtggaacccgttgagttttatcctgacgaccttgtgaagaagttcgtcggtgaactgaaa
cccatgtatcctctcctgggcacagaacacccggtaacgtggggacccctcgatctctac
gattactacttcgaacacaaaagacagcaaatagaagccatggaaaacgtgaagaaagtg
tttccggagatcgcaaaagagttcgaagagacgttcggcagaaagtactggttcgtcgaa
ccctacaaactggacgatgcagaacacgtgatggtggccctcggttccacgaacagcacg
ataaaatacgtcgtcgacgaactcagggaagaaggccacaaagttggcgcattgaagata
tggatgttcagaccgttcccgaaggaacaacttcaggagcttctcaacggtagaaagagc
gtcatcgtccttgacagggcagtctcttttggagcggaagcccccctgtatgaggctgtt
aaatcctccctgtacgaagtggccgcaagaccaagccttggatcctacgtttacggtctt
ggtggaagggatataaaaccggagcacatcagaaaggccttcgaggacgccataaacgga
aatctgatcgccgacgaacagagataccttggtctcagagaatga

DBGET integrated database retrieval system